Record in detail


General Info

  • lamp_id:L01A003074
  • Name:NLT41_HORVU
  • FullName:Non-specific lipid-transfer protein 4.1
  • Source:Hordeum vulgare
  • Mass:8662.9 Da
  • Sequence Length:90 aa
  • Isoelectric Point:9.24
  • Activity:Antibacterial, Antifungal
  • Sequence
        AISCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAAGGLNAGKAAGIPSMCGVSVPYAISASVDCSKIR
  • Function:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003074    From 1 To 90 E-value: 9.80909e-45 Score: 169
        AISCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAAGGLNAGKAAGIPSMCGVSVPYAISASVDCSKIR
  • 2. L06AT00107    From 1 To 90 E-value: 2.94273e-44 Score: 168
        AISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAGGLNAGKAAGIPSMCGVSVPYAISASVDCSKIR
  • 3. L06AT00135    From 1 To 90 E-value: 4.00001e-40 Score: 154
        AISCGQVSSALSPCISYARGSGSSPPAACCSGVRSLAGAARSTADKQAACKCIKSAAGGLNAGKAAGIPSKCGVSIPYAISSSVDCSKIR
  • 4. L06AT00137    From 1 To 90 E-value: 8e-36 Score: 140
        AISCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAGGLNPGKAASIPSKCGVSIPYSISASVDCSKIH
  • 5. L06AT00130    From 1 To 90 E-value: 1e-35 Score: 140
        AITCGQVSSALSPCIPYARGNGANPSAACCSGVRRIAGAVQSTADKKTACNCIKRAAGGLNAGKAADIPSKCSVSIPYAINPSVDCSTIR

Structure

  •   Domains
  •   1  Name:Bifunc_inhib/LTP/seed_store    Interpro Link:IPR016140
  •   2  Name:Lipid_transfer_prot_hlx-dom    Interpro Link:IPR013770
  •   3  Name:Plant_LTP    Interpro Link:IPR000528
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Garcia-Olmedo F.,Molina A.,
  •   Title:Developmental and pathogen-induced expression of three barley genes encoding lipid transfer proteins.
  •   Journal:Plant J., 1993, 4, 983-991  [MEDLINE:94108492]
  •   [2]  Garcia-Olmedo F.,Segura A.,Molina A.,
  •   Title:Lipid transfer proteins (nsLTPs) from barley and maize leaves are potent inhibitors of bacterial and fungal plant pathogens.
  •   Journal:FEBS Lett., 1993, 316, 119-122  [MEDLINE:93131027]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: