Record in detail
General Info
- lamp_id:L01A003081
- Name:KAB8_OLDAF
- FullName:Kalata-B8
- Source:Oldenlandia affinis
- Mass:3307.8 Da
- Sequence Length:31 aa
- Isoelectric Point:7.73
- Activity:Antiviral
- Sequence
GSVLNCGETCLLGTCYTTGCTCNKYRVCTKD - Function:Probably participates in a plant defense mechanism. Inhibits the cytopathic effects of the human immunodeficiency virus. Has no hemolytic activity.
Cross-Linking
- Cross-linking
- 1 Database:APD 730
- 2 Database:CAMP CAMPSQ956
- 3 Database:DBAASP 2536
- 4 Database:dbAMP dbAMP_04105
- 5 Database:DRAMP DRAMP00863
- 6 Database:SATPdb satpdb21495
- 7 Database:Uniprot P85175
- 8 Database:PHY PHYT00204
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003081 From 1 To 31 E-value: 0.000000000004 Score: 62
GSVLNCGETCLLGTCYTTGCTCNKYRVCTKD - 2. L02A001108 From 1 To 31 E-value: 0.0000000002 Score: 56.2
GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD - 3. L12A00828| From 1 To 26 E-value: 0.000000002 Score: 53.1
CGETCLLGTCYTTGCTCNKYRVCTKD - 4. L13A024065 From 1 To 30 E-value: 0.000003 Score: 42
GSVIKCGESCLLGKCYTPGCTCSR-PICKKD - 5. L02A001065 From 1 To 31 E-value: 0.000004 Score: 42
GSIPACGESCFKGKCYTPGCSCSKYPLCAKN
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Craik D.J.,Plan M.R.R.,Clark R.J.,Daly N.L.,
- Title:Kalata B8, a novel antiviral circular protein, exhibits conformational flexibility in the cystine knot motif.
- Journal:Biochem. J., 2006, 393, 619-626 [PubMed:16207177]
- [2] Colgrave M.L.,Daly N.L.,Clark R.J.,Goeransson U.,Plan M.R.R.,
- Title:The cyclotide fingerprint in Oldenlandia affinis: elucidation of chemically modified, linear and novel macrocyclic peptides.
- Journal:ChemBioChem, 2007, 8, 1001-1011 [PubMed:17534989]
Comments
- Comments
No comments found on LAMP database