Record in detail


General Info

  • lamp_id:L01A003081
  • Name:KAB8_OLDAF
  • FullName:Kalata-B8
  • Source:Oldenlandia affinis
  • Mass:3307.8 Da
  • Sequence Length:31 aa
  • Isoelectric Point:7.73
  • Activity:Antiviral
  • Sequence
        GSVLNCGETCLLGTCYTTGCTCNKYRVCTKD
  • Function:Probably participates in a plant defense mechanism. Inhibits the cytopathic effects of the human immunodeficiency virus. Has no hemolytic activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003081    From 1 To 31 E-value: 0.000000000004 Score: 62
        GSVLNCGETCLLGTCYTTGCTCNKYRVCTKD
  • 2. L02A001108    From 1 To 31 E-value: 0.0000000002 Score: 56.2
        GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
  • 3. L12A00828|    From 1 To 26 E-value: 0.000000002 Score: 53.1
        CGETCLLGTCYTTGCTCNKYRVCTKD
  • 4. L13A024065    From 1 To 30 E-value: 0.000003 Score: 42
        GSVIKCGESCLLGKCYTPGCTCSR-PICKKD
  • 5. L02A001065    From 1 To 31 E-value: 0.000004 Score: 42
        GSIPACGESCFKGKCYTPGCSCSKYPLCAKN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Craik D.J.,Plan M.R.R.,Clark R.J.,Daly N.L.,
  •   Title:Kalata B8, a novel antiviral circular protein, exhibits conformational flexibility in the cystine knot motif.
  •   Journal:Biochem. J., 2006, 393, 619-626  [PubMed:16207177]
  •   [2]  Colgrave M.L.,Daly N.L.,Clark R.J.,Goeransson U.,Plan M.R.R.,
  •   Title:The cyclotide fingerprint in Oldenlandia affinis: elucidation of chemically modified, linear and novel macrocyclic peptides.
  •   Journal:ChemBioChem, 2007, 8, 1001-1011  [PubMed:17534989]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: