Record in detail


General Info

  • lamp_id:L01A003100
  • Name:Q4GWV4_CRAGI
  • FullName:
  • Source:Crassostrea gigas
  • Mass:4642.3 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.41
  • Activity:Antibacterial, Antifungal
  • Sequence
        GFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003100    From 1 To 43 E-value: 2e-20 Score: 89.7
        GFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK
  • 2. L13A013236    From 1 To 43 E-value: 2e-19 Score: 86.3
        GFCCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK
  • 3. L05A0DEF33    From 1 To 43 E-value: 4e-17 Score: 78.2
        GFGCPRDQYKCNSHCQSIGCRAGYCDAVTLWLRCTCTDCNGKK
  • 4. L05A0DEF66    From 1 To 43 E-value: 3e-16 Score: 75.5
        GFGCPGDQYECNRHCRSIGCRAGYCDAVTLWLRCTCTGCSGKK
  • 5. L13A026355    From 1 To 43 E-value: 0.0000000002 Score: 56.2
        GFGCPEDEYECHNHCKNSVGCRGGYCDAGTLRQRCTCYGCNQK

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  M. lysodeikticus  MIC:  0.02 μg/ml  (0.00430821 μM)  
  •   2  Target:  S. aureus  MIC:  5.8 μg/ml  (1.24938 μM)  
  •   3  Target:  B. stationis  MIC:  0.46 μg/ml  (0.0990888 μM)  
  •   4  Target:  M. maritypicum  MIC:  2.32 μg/ml  (0.499752 μM)  
  •   5  Target:  B. megaterium  MIC:  92.85 μg/ml  (20.0009 μM)  
  •   6  Target:  E. coli 363  MIC:  162.48 μg/ml  (34.9999 μM)  
  •   7  Target:  V. alginolyticus  MIC:  92.85 μg/ml  (20.0009 μM)  
  •   8  Target:  S. typhimurium  MIC:  92.85 μg/ml  (20.0009 μM)  
  •   9  Target:  F. oxysporum  MIC:  44.1 μg/ml  (9.4996 μM)  
  •   10  Target:  B. cinerea  MIC:  92.85 μg/ml  (20.0009 μM)  
  •   11  Target:  P. crustosum  MIC:  92.85 μg/ml  (20.0009 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Fievet J.,Garnier J.,Aumelas A.,Herpin A.,Gueguen Y.,
  •   Title:Characterization of a defensin from the oyster Crassostrea gigas. Recombinant production, folding, solution structure, antimicrobial activities, and gene expression.
  •   Journal:J. Biol. Chem., 2006, 281, 313-323  [PubMed:16246846]
  •   [2]  de Lorgeril J.,Bachere E.,Desmarais E.,Gueguen Y.,Schmitt P.,
  •   Title:Molecular diversity of antimicrobial effectors in the oyster Crassostrea gigas.
  •   Journal:BMC Evol. Biol., 2010, 10, 23-23  [PubMed:20100329]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: