Record in detail
General Info
- lamp_id:L01A003107
- Name:STYE_STYCL
- FullName:Styelin-E
- Source:Styela clava
- Mass:3896.6 Da
- Sequence Length:33 aa
- Isoelectric Point:11.02
- Activity:Antibacterial
- Sequence
GWLRKAAKSVGKFYYKHKYYIKAAWKIGRHALG - Function:Bactericidal against several Gram-positive and Gram-negative bacteria (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1662
- 2 Database:dbAMP dbAMP_04385
- 3 Database:Uniprot O18496
- 4 Database:AMD STYD_STYCL
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A08954| From 23 To 55 E-value: 0.00000000000005 Score: 68.2
GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHALG - 2. L01A003107 From 1 To 33 E-value: 0.0000000000004 Score: 65.5
GWLRKAAKSVGKFYYKHKYYIKAAWKIGRHALG - 3. L02A000331 From 1 To 32 E-value: 0.000000000001 Score: 63.5
GWLRKAAKSVGKFYYKHKYYIKAAWKIGRHAL - 4. L01A000525 From 1 To 32 E-value: 0.000000000006 Score: 61.2
GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL - 5. L13A025503 From 1 To 31 E-value: 0.00000000002 Score: 59.3
GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHA
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Lehrer R.I.,Lee I.H.,Liaw L.,Zhao C.,
- Title:cDNA cloning of three cecropin-like antimicrobial peptides (Styelins) from the tunicate, Styela clava.
- Journal:FEBS Lett., 1997, 412, 144-148 [MEDLINE:97400214]
Comments
- Comments
No comments found on LAMP database