Record in detail
General Info
- lamp_id:L01A003111
- Name:OSTR1_STRCA
- FullName:Ostricacin-1
- Source:Struthio camelus
- Mass:4017.8 Da
- Sequence Length:36 aa
- Isoelectric Point:8.64
- Activity:Antibacterial
- Sequence
LFCRKGTCHFGGCPAHLVKVGSCFGFRACCKWPWDV - Function:Has antibacterial activity against the Gram-positive bacteria S.aureus 1056 MRSA (MIC=1.25 ug/ml) and S.aureus NCTC 4163 (MIC=6.7 ug/ml), and the Gram-negative bacteria E.coli O157:H7 (MIC=0.96 ug/ml) and E.coli 0111 (MIC=6.7 ug/ml). Does not have antifungal activity against the yeast C.albicans 3153A.
Cross-Linking
- Cross-linking
- 1 Database:APD 1320
- 2 Database:CAMP CAMPSQ973
- 3 Database:DBAASP 2046
- 4 Database:dbAMP dbAMP_05720
- 5 Database:DRAMP DRAMP03285
- 6 Database:SATPdb satpdb26030
- 7 Database:Uniprot P85113
- 8 Database:DEF DEF119
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003111 From 1 To 36 E-value: 2e-16 Score: 75.9
LFCRKGTCHFGGCPAHLVKVGSCFGFRACCKWPWDV - 2. L03A000255 From 29 To 64 E-value: 0.00000000000002 Score: 69.7
LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA - 3. L12A09039| From 29 To 64 E-value: 0.00000000000003 Score: 68.9
LFCKRGSCHFGRCPSHLIKVGSCFGFRSCCKWPWDA - 4. L05ADEF300 From 29 To 64 E-value: 0.00000000000005 Score: 68.2
LFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA - 5. L02A000267 From 1 To 36 E-value: 0.00000000000005 Score: 68.2
LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA
Structure
- Domains
- 1 Name:Defensin_beta-typ Interpro Link:IPR001855
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: S.aureus 1056 MRSA MIC: 1.25 μg/ml (0.311116 μM)
- 2 Target: S.aureus NCTC 4163 MIC: 6.7 μg/ml (1.66758 μM)
- 3 Target: E.coli O157:H7 MIC: 0.96 μg/ml (0.238937 μM)
- 4 Target: E.coli 0111 MIC: 6.7 μg/ml (1.66758 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Ahrens K.,Choudhury S.D.,Yu P.-L.,
- Title:Purification and characterization of the antimicrobial peptide, ostricacin.
- Journal:Biotechnol. Lett., 2001, 23, 207-210 [:]
- [2] Yu P.-L.,Sugiarto H.,
- Title:Identification of three novel ostricacins: an update on the phylogenetic perspective of beta-defensins.
- Journal:Int. J. Antimicrob. Agents, 2006, 27, 229-235 [PubMed:16459058]
Comments
- Comments
No comments found on LAMP database