Record in detail


General Info

  • lamp_id:L01A003111
  • Name:OSTR1_STRCA
  • FullName:Ostricacin-1
  • Source:Struthio camelus
  • Mass:4017.8 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.64
  • Activity:Antibacterial
  • Sequence
        LFCRKGTCHFGGCPAHLVKVGSCFGFRACCKWPWDV
  • Function:Has antibacterial activity against the Gram-positive bacteria S.aureus 1056 MRSA (MIC=1.25 ug/ml) and S.aureus NCTC 4163 (MIC=6.7 ug/ml), and the Gram-negative bacteria E.coli O157:H7 (MIC=0.96 ug/ml) and E.coli 0111 (MIC=6.7 ug/ml). Does not have antifungal activity against the yeast C.albicans 3153A.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003111    From 1 To 36 E-value: 2e-16 Score: 75.9
        LFCRKGTCHFGGCPAHLVKVGSCFGFRACCKWPWDV
  • 2. L03A000255    From 29 To 64 E-value: 0.00000000000002 Score: 69.7
        LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA
  • 3. L12A09039|    From 29 To 64 E-value: 0.00000000000003 Score: 68.9
        LFCKRGSCHFGRCPSHLIKVGSCFGFRSCCKWPWDA
  • 4. L05ADEF300    From 29 To 64 E-value: 0.00000000000005 Score: 68.2
        LFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA
  • 5. L02A000267    From 1 To 36 E-value: 0.00000000000005 Score: 68.2
        LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  S.aureus 1056 MRSA  MIC:  1.25 μg/ml  (0.311116 μM)  
  •   2  Target:  S.aureus NCTC 4163  MIC:  6.7 μg/ml  (1.66758 μM)  
  •   3  Target:  E.coli O157:H7  MIC:  0.96 μg/ml  (0.238937 μM)  
  •   4  Target:  E.coli 0111  MIC:  6.7 μg/ml  (1.66758 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ahrens K.,Choudhury S.D.,Yu P.-L.,
  •   Title:Purification and characterization of the antimicrobial peptide, ostricacin.
  •   Journal:Biotechnol. Lett., 2001, 23, 207-210  [:]
  •   [2]  Yu P.-L.,Sugiarto H.,
  •   Title:Identification of three novel ostricacins: an update on the phylogenetic perspective of beta-defensins.
  •   Journal:Int. J. Antimicrob. Agents, 2006, 27, 229-235  [PubMed:16459058]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: