Record in detail


General Info

  • lamp_id:L01A003112
  • Name:OSTR3_STRCA
  • FullName:Ostricacin-3
  • Source:Struthio camelus
  • Mass:4679.5 Da
  • Sequence Length:40 aa
  • Isoelectric Point:9.59
  • Activity:Antibacterial
  • Sequence
        IPRPLDPCIAQNGRCFTGICRYPYFWIGTCRNGKSCCRRR
  • Function:Has antibacterial activity against the Gram-positive bacterium S.aureus 1056 MRSA (MIC=2.78 ug/ml) and the Gram-negative bacterium E.coli O157:H7 (MIC=2.41 ug/ml). Does not have antifungal activity against the yeast C.albicans 3153A.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003112    From 1 To 40 E-value: 1e-18 Score: 83.6
        IPRPLDPCIAQNGRCFTGICRYPYFWIGTCRNGKSCCRRR
  • 2. L11A009702    From 1 To 40 E-value: 0.000000002 Score: 52.8
        IPRPIDTCRLRNGICFPGICRRPYYWIGTCNNGIGSCCAR
  • 3. L02A001325    From 4 To 43 E-value: 0.000000003 Score: 52.4
        IPRPIDTCRLRNGICFPGICRRPYYWIGTCNNGIGSCCAR
  • 4. L11A005006    From 4 To 43 E-value: 0.000000003 Score: 52.4
        IPRPIDTCRLRNGICFPGICRRPYYWIGTCNNGIGSCCAR
  • 5. L01A003414    From 1 To 38 E-value: 0.00000003 Score: 48.9
        RPIDTCRLRNGICFPGICRRPYYWIGTCNNGIGSCCAR

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  S.aureus 1056 MRSA  MIC:  2.78 μg/ml  (0.594081 μM)  
  •   2  Target:  E.coli O157:H7  MIC:  2.41 μg/ml  (0.515012 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Yu P.-L.,Sugiarto H.,
  •   Title:Identification of three novel ostricacins: an update on the phylogenetic perspective of beta-defensins.
  •   Journal:Int. J. Antimicrob. Agents, 2006, 27, 229-235  [PubMed:16459058]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: