Record in detail


General Info

  • lamp_id:L01A003113
  • Name:OSTR4_STRCA
  • FullName:Ostricacin-4
  • Source:Struthio camelus
  • Mass:4754.5 Da
  • Sequence Length:42 aa
  • Isoelectric Point:8.63
  • Activity:Antibacterial
  • Sequence
        LPVNEAQCRQVGGYCGLRICNFPSRFLGLCTRNHPCCSRVWV
  • Function:Has antibacterial activity against the Gram-positive bacterium S.aureus 1056 MRSA (MIC=11.48 ug/ml) and the Gram-negative bacterium E.coli O157:H7 (MIC=12.03 ug/ml). Does not have antifungal activity against the yeast C.albicans 3153A.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003113    From 1 To 42 E-value: 3e-20 Score: 88.6
        LPVNEAQCRQVGGYCGLRICNFPSRFLGLCTRNHPCCSRVWV
  • 2. L01A003153    From 2 To 41 E-value: 0.00002 Score: 39.3
        PGNKAECEREKGYCGFLKCSFPFVVSGKCSRFFFCCKNIW
  • 3. L05ADEF297    From 24 To 65 E-value: 0.0001 Score: 37
        VPNNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCCRTVY
  • 4. L12A07926|    From 25 To 62 E-value: 0.0001 Score: 37
        PGNEGQCKQEGGFCSFLTCYHPHHIFGRCSAFMVCCKR
  • 5. L11A003169    From 2 To 40 E-value: 0.0002 Score: 36.6
        NEAQCEQAGGRCSKDHCFHLHTRAFGHCQRGVPCCRRVY

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Yu P.-L.,Sugiarto H.,
  •   Title:Identification of three novel ostricacins: an update on the phylogenetic perspective of beta-defensins.
  •   Journal:Int. J. Antimicrob. Agents, 2006, 27, 229-235  [PubMed:16459058]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: