Record in detail


General Info

  • lamp_id:L01A003118
  • Name:MTCY_LEUME
  • FullName:Bacteriocin mesentericin Y105
  • Source:Leuconostoc mesenteroides
  • Mass:3870.3 Da
  • Sequence Length:37 aa
  • Isoelectric Point:8.77
  • Activity:Antibacterial
  • Sequence
        KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW
  • Function:Bacteriocin active against Listeria monocytogenes.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09479|    From 25 To 61 E-value: 3e-17 Score: 79
        KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW
  • 2. L01A003118    From 1 To 37 E-value: 1e-16 Score: 76.6
        KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW
  • 3. L12A08493|    From 25 To 61 E-value: 2e-16 Score: 76.3
        KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW
  • 4. L12A08826|    From 25 To 61 E-value: 2e-16 Score: 75.9
        KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW
  • 5. L12A05561|    From 1 To 36 E-value: 8e-16 Score: 73.9
        KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGF

Structure

  •   Domains
  •   1  Name:Bacteriocin_IIa    Interpro Link:IPR002633
  •   2  Name:Bacteriocin_IIa_CS    Interpro Link:IPR023384
  •   3  Name:Bacteriocin_IIa_dom    Interpro Link:IPR023388
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Cenatiempo Y.,Letellier F.,Derijard B.,Hechard Y.,
  •   Title:Characterization and purification of mesentericin Y105, an anti-Listeria bacteriocin from Leuconostoc mesenteroides.
  •   Journal:J. Gen. Microbiol., 1992, 138, 2725-2731  [MEDLINE:93139768]
  •   [2]  Cenatiempo Y.,Hechard A.,Fremaux C.,
  •   Title:Mesentericin Y105 gene clusters in Leuconostoc mesenteroides Y105.
  •   Journal:Microbiology, 1995, 141, 1637-1645  [MEDLINE:96004463]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: