Record in detail
General Info
- lamp_id:L01A003120
- Name:CRAMP_MOUSE
- FullName:Cathelin-related antimicrobial peptide
- Source:Mus musculus
- Mass:3750.5 Da
- Sequence Length:33 aa
- Isoelectric Point:11.01
- Activity:Antibacterial
- Sequence
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE - Function:Acts as a potent antimicrobial peptide.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ980
- 2 Database:dbAMP dbAMP_03587
- 3 Database:DRAMP DRAMP03405
- 4 Database:SATPdb satpdb23730
- 5 Database:Uniprot P51437
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L11A002031 From 6 To 38 E-value: 0.000000000001 Score: 63.5
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE - 2. L01A003119 From 6 To 38 E-value: 0.000000000001 Score: 63.5
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE - 3. L01A003120 From 1 To 33 E-value: 0.000000000002 Score: 62.8
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE - 4. L02A000281 From 1 To 33 E-value: 0.000000000002 Score: 62.8
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE - 5. L11A002032 From 6 To 38 E-value: 0.00000004 Score: 48.5
GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIE
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Belyavsky A.V.,Fibbe W.E.,Visser Y.W.M.,Zinovjeva M.V.,Popsueva A.E.,
- Title:A novel murine cathelin-like protein expressed in bone marrow.
- Journal:FEBS Lett., 1996, 391, 5-8 [MEDLINE:96326596]
- [2] Zanetti M.,Kozak C.A.,Bernfield M.,Kim K.J.,Gallo R.L.,
- Title:Identification of CRAMP, a cathelin-related antimicrobial peptide expressed in the embryonic and adult mouse.
- Journal:J. Biol. Chem., 1997, 272, 13088-13093 [MEDLINE:97294716]
- [3]
- Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
- Journal:Genome Res., 2004, 14, 2121-2127 [PubMed:15489334]
Comments
- Comments
No comments found on LAMP database