Record in detail


General Info

  • lamp_id:L01A003127
  • Name:Hepcidin antimicrobial peptide 2
  • FullName:Hepcidin antimicrobial peptide 2
  • Source:Mus musculus (house mouse)
  • Mass:6287.3 Da
  • Sequence Length:54 aa
  • Isoelectric Point:8.21
  • Activity:Antimicrobial
  • Sequence
        QMRQTTELQPLHGEESRADIAIPMQKRRKRDINFPICRFCCQCCNKPSCGICCE
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003127    From 1 To 54 E-value: 4e-27 Score: 111
        QMRQTTELQPLHGEESRADIAIPMQKRRKRDINFPICRFCCQCCNKPSCGICCE
  • 2. L03A000101    From 29 To 82 E-value: 8e-24 Score: 100
        QMRQTTELQPLHGEESRADIAIPMQKRRKRDTNFPICIFCCKCCNNSQCGICCK
  • 3. L03A000100    From 29 To 82 E-value: 0.00000000002 Score: 59.7
        QTRQTTALQPWHGAESKTDDSALLMLKRRKRDTNFPICLFCCKCCKNSSCGLCC
  • 4. L12A08786|    From 27 To 80 E-value: 0.00000000004 Score: 58.5
        QTKQLADLQAQDSAEAKASLTSVIQRRRSRDTHFPICMFCCGCCHRSKCGMCCK
  • 5. L12A06358|    From 29 To 82 E-value: 0.00000000006 Score: 58.2
        QTRQLADPQARDSAEAKASLMPAIQKRRSRDTHFPICVFCCGCCHKSNCGMCCK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: