Record in detail


General Info

  • lamp_id:L01A003147
  • Name:TXFK1_PSACA
  • FullName:U1-theraphotoxin-Pc1a
  • Source:Psalmopoeus cambridgei
  • Mass:3625.3 Da
  • Sequence Length:33 aa
  • Isoelectric Point:8.12
  • Activity:Antiparasitic
  • Sequence
        ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV
  • Function:Possess strong antiplasmodial activity against the intra-erythrocyte stage of P.falciparum in vitro. IC(50) for inhibiting P.falciparum growth is 1.59 uM. Interacts with infected and healthy erythrocytes. Does not lyse erythrocytes, is not cytotoxic to nucleated mammalian cells, and does not inhibit neuromuscular function. Has neither antibacterial nor antifungal activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003147    From 1 To 33 E-value: 0.00000000000002 Score: 69.3
        ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV
  • 2. L03A000161    From 45 To 64 E-value: 3 Score: 22.3
        PCCRGLTCRSYFPGSTYGRC
  • 3. L12A08087|    From 45 To 64 E-value: 3.1 Score: 22.3
        PCCRGLTCRSYFPGSTYGRC
  • 4. L01A002992    From 22 To 41 E-value: 4.8 Score: 21.6
        PCCRGLTCRSYFPGSTYGRC
  • 5. L01A002892    From 22 To 41 E-value: 5.1 Score: 21.6
        PCCRGLTCRSYFPGSTYGRC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Delarbre C.,Deregnaucourt C.,Guillaume C.,Parent R.,Choi S.-J.,
  •   Title:Isolation and characterization of Psalmopeotoxin I and II: two novel antimalarial peptides from the venom of the tarantula Psalmopoeus cambridgei.
  •   Journal:FEBS Lett., 2004, 572, 109-117  [PubMed:15304333]
  •   [2]  Camadro J.-M.,Guette C.,Chagot B.,Choi S.-J.,Pimentel C.,
  •   Title:Solution structure of PcFK1, a spider peptide active against Plasmodium falciparum.
  •   Journal:Protein Sci., 2006, 15, 628-634  [PubMed:16452619]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: