Record in detail
General Info
- lamp_id:L01A003147
- Name:TXFK1_PSACA
- FullName:U1-theraphotoxin-Pc1a
- Source:Psalmopoeus cambridgei
- Mass:3625.3 Da
- Sequence Length:33 aa
- Isoelectric Point:8.12
- Activity:Antiparasitic
- Sequence
ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV - Function:Possess strong antiplasmodial activity against the intra-erythrocyte stage of P.falciparum in vitro. IC(50) for inhibiting P.falciparum growth is 1.59 uM. Interacts with infected and healthy erythrocytes. Does not lyse erythrocytes, is not cytotoxic to nucleated mammalian cells, and does not inhibit neuromuscular function. Has neither antibacterial nor antifungal activity.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ984
- 2 Database:DBAASP 4467
- 3 Database:dbAMP dbAMP_00081
- 4 Database:DRAMP DRAMP00297
- 5 Database:SATPdb satpdb10565
- 6 Database:Uniprot P0C201
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003147 From 1 To 33 E-value: 0.00000000000002 Score: 69.3
ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV - 2. L03A000161 From 45 To 64 E-value: 3 Score: 22.3
PCCRGLTCRSYFPGSTYGRC - 3. L12A08087| From 45 To 64 E-value: 3.1 Score: 22.3
PCCRGLTCRSYFPGSTYGRC - 4. L01A002992 From 22 To 41 E-value: 4.8 Score: 21.6
PCCRGLTCRSYFPGSTYGRC - 5. L01A002892 From 22 To 41 E-value: 5.1 Score: 21.6
PCCRGLTCRSYFPGSTYGRC
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Delarbre C.,Deregnaucourt C.,Guillaume C.,Parent R.,Choi S.-J.,
- Title:Isolation and characterization of Psalmopeotoxin I and II: two novel antimalarial peptides from the venom of the tarantula Psalmopoeus cambridgei.
- Journal:FEBS Lett., 2004, 572, 109-117 [PubMed:15304333]
- [2] Camadro J.-M.,Guette C.,Chagot B.,Choi S.-J.,Pimentel C.,
- Title:Solution structure of PcFK1, a spider peptide active against Plasmodium falciparum.
- Journal:Protein Sci., 2006, 15, 628-634 [PubMed:16452619]
Comments
- Comments
No comments found on LAMP database