Record in detail


General Info

  •   lamp_id:L01A003147
      Name:TXFK1_PSACA
      FullName:U1-theraphotoxin-Pc1a
      Source:Psalmopoeus cambridgei
      Mass:3625.3
      Sequence Length:33
      Sequence
        ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV
      Isoelectric Point:8.12
      Activity:Antiparasitic
      Function:Possess strong antiplasmodial activity against the intra-erythrocyte stage of P.falciparum in vitro. IC(50) for inhibiting P.falciparum growth is 1.59 uM. Interacts with infected and healthy erythrocytes. Does not lyse erythrocytes, is not cytotoxic to nucleated mammalian cells, and does not inhibit neuromuscular function. Has neither antibacterial nor antifungal activity.

Cross-Linking

  •   Cross-linking
  •   1  Database:SWISS  P0C201
  •   2  Database:CAMP  3147

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003147    From 1 To 33 E-value: 0.000000000000007 Score: 69.3
        ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV
  • 2. L03A000161    From 45 To 64 E-value: 0.96 Score: 22.3
        PCCRGLTCRSYFPGSTYGRC
  • 3. L01A002992    From 22 To 41 E-value: 1.6 Score: 21.6
        PCCRGLTCRSYFPGSTYGRC
  • 4. L01A002892    From 22 To 41 E-value: 1.7 Score: 21.6
        PCCRGLTCRSYFPGSTYGRC
  • 5. L02A001479    From 12 To 24 E-value: 6.7 Score: 19.6
        RSFGCRFGTCTVQ

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures
  •   1
    1X5V
    Method:NMR
    Chains:A=52-84

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Camadro J.-M.,Guette C.,Chagot B.,Choi S.-J.,Pimentel C.,
  •   Title:Solution structure of PcFK1, a spider peptide active against Plasmodium falciparum.
  •   Journal:Protein Sci.,2006,(15):628-634  [PubMed:16452619]
  •   [2]  Delarbre C.,Deregnaucourt C.,Guillaume C.,Parent R.,Choi S.-J.,
  •   Title:Isolation and characterization of Psalmopeotoxin I and II: two novel antimalarial peptides from the venom of the tarantula Psalmopoeus cambridgei.
  •   Journal:FEBS Lett.,2004,(572):109-117  [PubMed:15304333]

Comments

  •   Comments
  •   [1]  ALCO BLOCKER ?????????? ????? ???????????? ?????????? ? ALCO BLOCKER ?????? ?????? ?? ???????! ??? ?????? ????????? ???????????? ????????, ?????????????? ????????? ??????????????? ???????? ??? ?????????? ?????? ?????? ? ???????? ????????, ??????? ??????? ? ??? ?????? ?????????? ??????????! ????? ????, ?? ????????? ?????? ??????????????? ????????, ???????? ??????????? ???????????? ? ??????????? ?????????????? ?????????? ?????? ??????? ? ??????. ??????????? ????: http://alcoblocker.cteamshops.com
  •   ----  xe.z.ner@hceap.info   at  2017-06-01 00:34:28
  •   [2]  http://zabgen.predistoria.org/forum/index.php?topic=914.0 http://forum.dilsadakcaoglu.com/User-WilliamCepOw http://www.societe.se/toansKvarn.jpg.html http://fffstrength.com.au/forums/viewtopic.php?f=4&t=109163&p=126807 http://8ola.net/archive/index.php/t-778.html?pda=1 http://nofame.ru/showthread.php?p=254973 https://forums.librocket.com/viewtopic.php?f=2&t=5788&p=8399 http://www.technopole-sousse.rnrt.tn/forum/memberlist.php?mode=joined&order=ASC&start=206500 http://cherkizovo.cviter.ru/viewtopic.php?f=6&t=44397 http://mywordpress.ru/support/viewtopic.php?pid=150194 http://ella3.com/showthread.php?p=102169 http://archangelvideo.com/forum/memberlist.php?sk=d&sd=a&first_char=j&mode=searchuser&start=1425 http://capcus.org/showthread.php?315-Hot-promo-idrpoker-com-agen-poker-dan-domino-terpercaya&p=14146 http://www.aquabike.pro/forum/viewtopic.php?f=7&t=5&start=70 http://sport-up.com.ua/forum/viewtopic.php?f=34&t=11173&p=27527 http://www.golovachev.ru/forum/showthread.php?t=1003&page=6 http://forum.hasselquist.net/search.php?st=0&sk=t&sd=d&sr=posts&author_id=24828&start=15 http://thedonbradmans.com/modlogan/m_usage_201504_001_002.html http://www.thetapsite.com/stats/usage_201504.html http://www.acc4arab.com/acc/showthread.php/147620-?????????-???????-???????-??????4-?????????-p=1039607354 e?c??I?i?a???a?e??a?a?i??i?i?a??I?a?a?a??a??c??a?a???e?i???i?www.myjavaserver.com/~phentermine1/www.brilly.de/images/templates/statistics.php?extensive=refdomains http://missosology.info/~missyorg/forum/viewtopic.php?p=5343040 http://8ola.net/archive/index.php/t-1252.html?pda=1 https://www.starneteclipse.com/starnetnew/forum/list.php?author/73411-elifofofu http://www.privat-club.cz/en/guestbook.html?page=4&re=16&re=13&re=1&re=11&re=7&re=10&re=6&re=14&re=8&re=15&re=9&re=12&re=836
  •   ----  julio@1stbest.info   at  2017-04-17 11:00:22
  •   [3]  Jemma22 September 2012Michael I have just read all of your blog entries in one go (having read none befroe) and I must say it was more interesting and entertaining than most books I have read. Please blog more. We miss you guys xx
  •   ----  54cxtchs@gmail.com   at  2014-07-06 00:17:44



CAPTCHA Image   Reload Image
Enter Code*: