Record in detail


General Info

  • lamp_id:L01A003153
  • Name:OSTR2_STRCA
  • FullName:Ostricacin-2
  • Source:Struthio camelus
  • Mass:4688.5 Da
  • Sequence Length:41 aa
  • Isoelectric Point:8.62
  • Activity:Antibacterial, Antifungal
  • Sequence
        APGNKAECEREKGYCGFLKCSFPFVVSGKCSRFFFCCKNIW
  • Function:Has antibacterial activity against the Gram-positive bacterium S.aureus 1056 MRSA (MIC=1.25 ug/ml) and the Gram-negative bacterium E.coli O157:H7 (MIC=0.96 ug/ml). Has antifungal activity against the yeast C.albicans 3153A (MIC=6.20 ug/ml).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003153    From 1 To 41 E-value: 7e-19 Score: 84.3
        APGNKAECEREKGYCGFLKCSFPFVVSGKCSRFFFCCKNIW
  • 2. L12A09053|    From 24 To 64 E-value: 0.000000000000006 Score: 71.2
        APRNKEKCHREKGFCGFLKCSFPFIISGKCSRFFFCCKKIF
  • 3. L12A09054|    From 24 To 64 E-value: 0.000000001 Score: 53.5
        ALGRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIW
  • 4. L03A000259    From 24 To 64 E-value: 0.000000002 Score: 53.1
        ALGRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIW
  • 5. L01A000658    From 1 To 39 E-value: 0.000000005 Score: 51.6
        GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIW

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  C.albicans 3153A  MIC:  6.2 μg/ml  (1.32238 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Yu P.-L.,Sugiarto H.,
  •   Title:Identification of three novel ostricacins: an update on the phylogenetic perspective of beta-defensins.
  •   Journal:Int. J. Antimicrob. Agents, 2006, 27, 229-235  [PubMed:16459058]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: