Record in detail


General Info

  • lamp_id:L01A003178
  • Name:Brevinin-2TSa
  • FullName:Brevinin-2TSa
  • Source:Rana tsushimensis
  • Mass:3361.1 Da
  • Sequence Length:33 aa
  • Isoelectric Point:10.23
  • Activity:Antibacterial
  • Sequence
        GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003178    From 1 To 33 E-value: 0.0000000000002 Score: 65.9
        GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC
  • 2. L12A07364|    From 42 To 74 E-value: 0.00000000005 Score: 58.2
        GLLSVFKGVLKTAGKHVAGSLLHQLKCKISGGC
  • 3. L03A000043    From 1 To 33 E-value: 0.0000000005 Score: 54.7
        GLFNVFKGALKTAGKHVAGSLLNQLKCKVSGGC
  • 4. L12A07173|    From 41 To 73 E-value: 0.000000001 Score: 53.9
        GLFNVFKGALKTAGKHVAGSLLNQLKCKVSGEC
  • 5. L02A000822    From 1 To 33 E-value: 0.000000001 Score: 53.5
        GIFNVFKGALKTAGKHVAGSLLNQLKCKVSGEC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  10.08 μg/ml  (2.99902 μM)  
  •   2  Target:  Klebsiella pneumoniae KK3 9904  MIC:  20.17 μg/ml  (6.00101 μM)  
  •   3  Target:  Enterobacter cloacae HNTCC 53001  MIC:  20.17 μg/ml  (6.00101 μM)  
  •   4  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  20.17 μg/ml  (6.00101 μM)  
  •   5  Target:  Proteus mirabilis ATCC 25933  MIC:  336.11 μg/ml  (100 μM)  
  •   6  Target:  Staphylococcus aureus NCTC 8325  MIC:  42.01 μg/ml  (12.4989 μM)  
  •   7  Target:  Methicillin-resistant Staphylococcus aureus T7/20  MIC:  84.03 μg/ml  (25.0007 μM)  
  •   8  Target:  Staphylococcus epidermidis RP62A  MIC:  42.01 μg/ml  (12.4989 μM)  
  •   9  Target:  Enterococcus faecalis ATCC 29212  MIC:  84.03 μg/ml  (25.0007 μM)  
  •   10  Target:  Candida albicans ATCC 90028  MIC:  336.11 μg/ml  (100 μM)  
  •   11  Target:  E. coli  MIC:  10.0833 μg/ml  (3 μM)  
  •   12  Target:  S. aureus  MIC:  42.0138 μg/ml  (12.5 μM)  

Toxicity

  •   Toxicity

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: