Record in detail


General Info

  • lamp_id:L01A003198
  • Name:Reptilian Defensin
  • FullName:Reptilian Defensin
  • Source:Caretta caretta (Loggerhead turtle)
  • Mass:4081 Da
  • Sequence Length:36 aa
  • Isoelectric Point:9.47
  • Activity:Antibacterial, Antiviral
  • Sequence
        EKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003198    From 1 To 36 E-value: 0.000000000000002 Score: 72.8
        EKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK
  • 2. L13A014239    From 1 To 36 E-value: 0.000000000000003 Score: 72
        QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK
  • 3. L11A003002    From 2 To 36 E-value: 0.000000000000007 Score: 70.9
        KKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK
  • 4. L01A003053    From 50 To 76 E-value: 0.61 Score: 24.6
        GWCRSKCFRHEYVDTYYSAVCGRYFCC
  • 5. L12A10365|    From 7 To 32 E-value: 0.97 Score: 23.9
        PGRCKMYCNSQERSI--FTCDRYKLCCI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: