Record in detail


General Info

  • lamp_id:L01A003202
  • Name:Manduca Sexta Moricin
  • FullName:Manduca Sexta Moricin
  • Source:Synthetic
  • Mass:4538.5 Da
  • Sequence Length:42 aa
  • Isoelectric Point:12.03
  • Activity:Antibacterial
  • Sequence
        GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003202    From 1 To 42 E-value: 2e-18 Score: 82.4
        GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH
  • 2. L01A003197    From 1 To 41 E-value: 0.0000000000003 Score: 65.5
        GKIPVKAIKKAGAAIGKGLRAINIASTAHDVYSFFKPKHKK
  • 3. L12A07895|    From 25 To 64 E-value: 0.000000000002 Score: 63.2
        GKIPVGAIKKAGRAIGKGLRAINIASTAHDVYTFFKPKKR
  • 4. L12A07894|    From 25 To 64 E-value: 0.000000000002 Score: 62.8
        GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKR
  • 5. L01A002394    From 1 To 40 E-value: 0.000000000003 Score: 62.4
        GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: