Record in detail
General Info
- lamp_id:L01A003232
- Name:AMP23_MACIN
- FullName:Vicilin-like antimicrobial peptides 2-3
- Source:Macadamia integrifolia
- Mass:5182.6 Da
- Sequence Length:41 aa
- Isoelectric Point:4.46
- Activity:Antibacterial, Antifungal
- Sequence
DPQTECQQCQRRCRQQESDPRQQQYCQRRCKEICEEEEEYN - Function:Antimicrobial peptides 2b, 2c and 2d have antibacterial and antifungal activity against a range of species.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1698
- 2 Database:dbAMP dbAMP_01158
- 3 Database:DRAMP DRAMP01032
- 4 Database:Uniprot Q9SPL3
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003232 From 1 To 41 E-value: 3e-16 Score: 75.5
DPQTECQQCQRRCRQQESDPRQQQYCQRRCKEICEEEEEYN - 2. L13A014452 From 1 To 41 E-value: 0.000001 Score: 43.9
DPQTECQQCQRRCRQQESGPRQQQYCQRRCKEICEEEEEYN - 3. L01A003226 From 1 To 41 E-value: 0.000002 Score: 43.1
DPQTDCQQCQRRCRQQESGPRQQQYCQRRCKEICEEEEEYN - 4. L01A003233 From 4 To 40 E-value: 0.002 Score: 32.7
DPQQQYEQCQKRCQRRETEPRHMQICQQRCERRYEKE - 5. L01A003235 From 4 To 41 E-value: 0.002 Score: 32.7
DPQQQYEQCQKRCQRRETEPRHMQICQQRCERRYEKEK
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Manners J.M.,Goulter K.C.,Green J.L.,Marcus J.P.,
- Title:A family of antimicrobial peptides is produced by processing of a 7S globulin protein in Macadamia integrifolia kernels.
- Journal:Plant J., 1999, 19, 699-710 [MEDLINE:20040040]
Comments
- Comments
No comments found on LAMP database