Record in detail


General Info

  • lamp_id:L01A003234
  • Name:AMP23_MACIN
  • FullName:Vicilin-like antimicrobial peptides 2-3
  • Source:Macadamia integrifolia
  • Mass:6220 Da
  • Sequence Length:47 aa
  • Isoelectric Point:10.71
  • Activity:Antibacterial, Antifungal
  • Sequence
        RQRDPQQQYEQCQKRCQRRETEPRHMQICQQRCERRYEKEKRKQQKR
  • Function:Antimicrobial peptides 2b, 2c and 2d have antibacterial and antifungal activity against a range of species.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003233    From 1 To 47 E-value: 5e-19 Score: 84.7
        RQRDPQQQYEQCQKRCQRRETEPRHMQICQQRCERRYEKEKRKQQKR
  • 2. L01A003234    From 1 To 47 E-value: 8e-19 Score: 84
        RQRDPQQQYEQCQKRCQRRETEPRHMQICQQRCERRYEKEKRKQQKR
  • 3. L01A000666    From 1 To 47 E-value: 5e-18 Score: 81.6
        RQRDPQQQYEQCQKHCQRRETEPRHMQTCQQRCERRYEKEKRKQQKR
  • 4. L01A003235    From 1 To 45 E-value: 6e-18 Score: 81.3
        RQRDPQQQYEQCQKRCQRRETEPRHMQICQQRCERRYEKEKRKQQ
  • 5. L01A003227    From 1 To 47 E-value: 2e-17 Score: 79.7
        RQRDPQQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKR

Structure

  •   Domains
  •   1  Name:Cupin_1    Interpro Link:IPR006045
  •   2  Name:Cupin_RmlC_type    Interpro Link:IPR011051
  •   3  Name:RmlC-like_jellyroll    Interpro Link:IPR014710
  •   4  Name:Vicilin_N    Interpro Link:IPR006792
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Manners J.M.,Goulter K.C.,Green J.L.,Marcus J.P.,
  •   Title:A family of antimicrobial peptides is produced by processing of a 7S globulin protein in Macadamia integrifolia kernels.
  •   Journal:Plant J., 1999, 19, 699-710  [MEDLINE:20040040]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: