Record in detail


General Info

  • lamp_id:L01A003243
  • Name:CAMP_NOMGA
  • FullName:Cathelicidin antimicrobial peptide
  • Source:Nomascus gabriellae
  • Mass:4467.3 Da
  • Sequence Length:37 aa
  • Isoelectric Point:11.65
  • Activity:Antibacterial
  • Sequence
        LPGNFFRKAREKIGKEFKRIVQRIKDFLQHLVPRTEA
  • Function:Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003243    From 1 To 37 E-value: 2e-16 Score: 75.9
        LPGNFFRKAREKIGKEFKRIVQRIKDFLQHLVPRTEA
  • 2. L01A003247    From 1 To 37 E-value: 0.000000000000002 Score: 72.8
        LLGNFFRKAREKIGKEFKRIVQRIKDFLQHLVPRTEA
  • 3. L01A002749    From 3 To 37 E-value: 0.00000000000005 Score: 68.2
        GNFFRKARKKIGEEFKRIVQRIKDFLQHLIPRTEA
  • 4. L11A011557    From 1 To 37 E-value: 0.0000000000006 Score: 64.3
        [LL-37, 37 aa]
  • 5. L11A007840    From 1 To 37 E-value: 0.0000000000007 Score: 64.3
        LLGDFFRKAKEKIGKEFKRIVQRIKDFLRNLVPRTES

Structure

  •   Domains
  •   1  Name:Cathelicidin    Interpro Link:IPR001894
  •   2  Name:Cathelicidin_CS    Interpro Link:IPR018216
  •   3  Name:Cathlecidin_C    Interpro Link:IPR022746
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Segat L.,Antcheva N.,Puzzi L.,Pontillo A.,Zelezetsky I.,
  •   Title:Evolution of the primate cathelicidin. Correlation between structural variations and antimicrobial activity.
  •   Journal:J. Biol. Chem., 2006, 281, 19861-19871  [PubMed:16720578]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: