Record in detail


General Info

  • lamp_id:L01A003255
  • Name:DEF1A_CAVPO
  • FullName:Neutrophil cationic peptide 1 type A
  • Source:Cavia porcellus
  • Mass:3838.5 Da
  • Sequence Length:31 aa
  • Isoelectric Point:9.62
  • Activity:Antibacterial, Antifungal, Antiviral
  • Sequence
        RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • Function:Has antibiotic, anti-fungi and antiviral activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09265|    From 63 To 93 E-value: 0.0000000000001 Score: 66.6
        RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • 2. L12A09266|    From 63 To 93 E-value: 0.0000000000001 Score: 66.6
        RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • 3. L12A09267|    From 63 To 93 E-value: 0.0000000000003 Score: 65.9
        RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC
  • 4. L01A003255    From 1 To 31 E-value: 0.000000000005 Score: 61.6
        RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC
  • 5. L01A000143    From 1 To 31 E-value: 0.000000000008 Score: 60.8
        RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Harwig S.S.L.,Selsted M.E.,
  •   Title:Purification, primary structure, and antimicrobial activities of a guinea pig neutrophil defensin.
  •   Journal:Infect. Immun., 1987, 55, 2281-2286  [MEDLINE:87306884]
  •   [2]  Saito K.,Yamashita T.,
  •   Title:Purification, primary structure, and biological activity of guinea pig neutrophil cationic peptides.
  •   Journal:Infect. Immun., 1989, 57, 2405-2409  [MEDLINE:89307555]
  •   [3]  Yamashita T.,Iwabuchi K.,Someya A.,Nagaoka I.,
  •   Title:Characterization of cDNA clones encoding guinea pig neutrophil cationic peptides.
  •   Journal:FEBS Lett., 1991, 280, 287-291  [MEDLINE:91192152]
  •   [4]  Solomon S.,Lazure C.,Bennett H.P.J.,Hu J.,
  •   Title:Isolation and characterization of corticostatic peptides from guinea pig bone marrow.
  •   Journal:Biochem. Biophys. Res. Commun., 1991, 180, 558-565  [MEDLINE:92062075]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: