Record in detail


General Info

  • lamp_id:L01A003260
  • Name:LEAP2_PIG
  • FullName:Liver-expressed antimicrobial peptide 2
  • Source:Sus scrofa
  • Mass:4599.3 Da
  • Sequence Length:40 aa
  • Isoelectric Point:9.11
  • Activity:Antimicrobial
  • Sequence
        MTPFWRAVSLRPIGASCRDDSECLTRLCRKRRCSLSVAQE
  • Function:Has an antimicrobial activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003260    From 1 To 40 E-value: 3e-18 Score: 82.4
        MTPFWRAVSLRPIGASCRDDSECLTRLCRKRRCSLSVAQE
  • 2. L12A09611|    From 38 To 77 E-value: 3e-18 Score: 82
        MTPFWRAVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
  • 3. L12A09612|    From 38 To 77 E-value: 3e-18 Score: 82
        MTPFWRAVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
  • 4. L12A12027|    From 37 To 76 E-value: 4e-18 Score: 81.6
        MTPFWRAVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
  • 5. L01A003257    From 1 To 40 E-value: 4e-18 Score: 81.6
        MTPFWRAVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE

Structure

  •   Domains
  •   1  Name:LEAP-2    Interpro Link:IPR009955
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Maronde E.,Kluever E.,Kleemeier B.,Sillard R.,Krause A.,
  •   Title:Isolation and biochemical characterization of LEAP-2, a novel blood peptide expressed in the liver.
  •   Journal:Protein Sci., 2003, 12, 143-152  [MEDLINE:22381985]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: