Record in detail


General Info

  • lamp_id:L01A003269
  • Name:KA2_MESMA
  • FullName:Peptide BmKa2
  • Source:Mesobuthus martensii
  • Mass:5888.2 Da
  • Sequence Length:50 aa
  • Isoelectric Point:2.67
  • Activity:Antimicrobial
  • Sequence
        YPASMDNYDDALEELDNLDLDDYFDLEPADFVLLDMWANMLESSDFDDME
  • Function:Highly acidic peptide that may have antibacterial activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003269    From 1 To 50 E-value: 1e-21 Score: 93.6
        YPASMDNYDDALEELDNLDLDDYFDLEPADFVLLDMWANMLESSDFDDME
  • 2. L01A003284    From 27 To 50 E-value: 0.00001 Score: 40.4
        EPADLVLLDMWANMLDSQDFEDFE
  • 3. L01A003282    From 32 To 50 E-value: 0.002 Score: 32.7
        VLLDMWANMLDSQDFEDFE
  • 4. L01A003285    From 32 To 50 E-value: 0.002 Score: 32.7
        VLLDMWANMLDSQDFEDFE
  • 5. L01A003283    From 32 To 50 E-value: 0.002 Score: 32.7
        VLLDMWANMLDSQDFEDFE

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Li W.-X.,Zhu S.-Y.,Zhu Y.,Wang S.-X.,Zeng X.-C.,
  •   Title:Identification and functional characterization of novel scorpion venom peptides with no disulfide bridge from Buthus martensii Karsch.
  •   Journal:Peptides, 2004, 25, 143-150  [PubMed:15062994]
  •   [2]  Liu H.,Cao Z.-J.,Hahin R.,Zeng X.-C.,Luo F.,
  •   Title:Genomic organization of four novel nondisulfide-bridged peptides from scorpion Mesobuthus martensii Karsch: gaining insight into evolutionary mechanism.
  •   Journal:Peptides, 2005, 26, 2427-2433  [PubMed:16040157]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: