Record in detail


General Info

  • lamp_id:L01A003270
  • Name:DIAP_GASAT
  • FullName:Diapause-specific peptide
  • Source:Gastrophysa atrocyanea
  • Mass:4473.1 Da
  • Sequence Length:41 aa
  • Isoelectric Point:8.12
  • Activity:Antifungal
  • Sequence
        AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN
  • Function:Has antifungal activity against T.rubrum. Blocks voltage-dependent N-type calcium channels (Cav2.2 / CACNA1B).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07373|    From 25 To 65 E-value: 3e-20 Score: 89
        AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN
  • 2. L01A003270    From 1 To 41 E-value: 3e-19 Score: 85.5
        AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN
  • 3. L12A10828|    From 1 To 38 E-value: 0.0000000007 Score: 54.3
        RVGPCDQVCSRIDAEKDECCRAHGYSGYNSCRGGRMDC
  • 4. L01A002349    From 5 To 39 E-value: 0.000000008 Score: 50.8
        VRVPPCDQVCSRTNPEKDECCRAHGHAFHATCSGG
  • 5. L11A009209    From 8 To 42 E-value: 0.00000001 Score: 50.4
        VRVPPCDQVCSRSNPEKDECCRAHGHAFHAHCNGG

Structure

  •   Domains
  •   1  Name:Antimicrobial_6    Interpro Link:IPR012525
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sato K.,Yamashita T.,An Y.,Sudo C.,Tanaka H.,
  •   Title:Relationship between the introduced and indigenous parasitoids Torymus sinensis and T. beneficus (Hymenoptera: Torymidae), as inferred from mt-DNA (COI) sequences.
  •   Journal:Appl. Entomol. Zool. (Jpn.), 1998, 33, 535-543  [:]
  •   [2]  Agoh M.,Yamashita T.,Saito Y.,Sato K.,Tanaka H.,
  •   Title:Insect diapause-specific peptide from the leaf beetle has consensus with a putative iridovirus peptide.
  •   Journal:Peptides, 2003, 24, 1327-1333  [PubMed:14706547]
  •   [3]  Suzuki K.,Tanaka H.,
  •   Title:Expression profiling of a diapause-specific peptide (DSP) of the leaf beetle Gastrophysa atrocyanea and silencing of DSP by double-strand RNA.
  •   Journal:J. Insect Physiol., 2005, 51, 701-707  [PubMed:15936770]
  •   [4]  Mori Y.,Yang P.,Tanaka H.,Mizuguchi M.,Kouno T.,
  •   Title:The structure of a novel insect peptide explains its Ca(2+) channel blocking and antifungal activities.
  •   Journal:Biochemistry, 2007, 46, 13733-13741  [PubMed:17994764]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: