Record in detail
General Info
- lamp_id:L01A003270
- Name:DIAP_GASAT
- FullName:Diapause-specific peptide
- Source:Gastrophysa atrocyanea
- Mass:4473.1 Da
- Sequence Length:41 aa
- Isoelectric Point:8.12
- Activity:Antifungal
- Sequence
AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN - Function:Has antifungal activity against T.rubrum. Blocks voltage-dependent N-type calcium channels (Cav2.2 / CACNA1B).
Cross-Linking
- Cross-linking
- 1 Database:APD 1166
- 2 Database:CAMP CAMPSQ1055
- 3 Database:dbAMP dbAMP_00737
- 4 Database:DRAMP DRAMP02743
- 5 Database:SATPdb satpdb27486
- 6 Database:Uniprot Q8T0W8
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A07373| From 25 To 65 E-value: 3e-20 Score: 89
AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN - 2. L01A003270 From 1 To 41 E-value: 3e-19 Score: 85.5
AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN - 3. L12A10828| From 1 To 38 E-value: 0.0000000007 Score: 54.3
RVGPCDQVCSRIDAEKDECCRAHGYSGYNSCRGGRMDC - 4. L01A002349 From 5 To 39 E-value: 0.000000008 Score: 50.8
VRVPPCDQVCSRTNPEKDECCRAHGHAFHATCSGG - 5. L11A009209 From 8 To 42 E-value: 0.00000001 Score: 50.4
VRVPPCDQVCSRSNPEKDECCRAHGHAFHAHCNGG
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Sato K.,Yamashita T.,An Y.,Sudo C.,Tanaka H.,
- Title:Relationship between the introduced and indigenous parasitoids Torymus sinensis and T. beneficus (Hymenoptera: Torymidae), as inferred from mt-DNA (COI) sequences.
- Journal:Appl. Entomol. Zool. (Jpn.), 1998, 33, 535-543 [:]
- [2] Agoh M.,Yamashita T.,Saito Y.,Sato K.,Tanaka H.,
- Title:Insect diapause-specific peptide from the leaf beetle has consensus with a putative iridovirus peptide.
- Journal:Peptides, 2003, 24, 1327-1333 [PubMed:14706547]
- [3] Suzuki K.,Tanaka H.,
- Title:Expression profiling of a diapause-specific peptide (DSP) of the leaf beetle Gastrophysa atrocyanea and silencing of DSP by double-strand RNA.
- Journal:J. Insect Physiol., 2005, 51, 701-707 [PubMed:15936770]
- [4] Mori Y.,Yang P.,Tanaka H.,Mizuguchi M.,Kouno T.,
- Title:The structure of a novel insect peptide explains its Ca(2+) channel blocking and antifungal activities.
- Journal:Biochemistry, 2007, 46, 13733-13741 [PubMed:17994764]
Comments
- Comments
No comments found on LAMP database