Record in detail


General Info

  • lamp_id:L01A003271
  • Name:AMP1_PINMO
  • FullName:Antimicrobial peptide 1
  • Source:Pinus monticola
  • Mass:8569.3 Da
  • Sequence Length:79 aa
  • Isoelectric Point:8.37
  • Activity:Antimicrobial
  • Sequence
        SYFSAWAGPGCNNHNARYSKCGCSNIGHNVHGGYEFVYQGQTAAAYNTDNCKGVAQTRFSSSVNQACSNFGWKSVFIQC
  • Function:Antimicrobial peptide (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003271    From 1 To 79 E-value: 3.00018e-42 Score: 161
        SYFSAWAGPGCNNHNARYSKCGCSNIGHNVHGGYEFVYQGQTAAAYNTDNCKGVAQTRFSSSVNQACSNFGWKSVFIQC
  • 2. L01A002890    From 1 To 79 E-value: 4e-39 Score: 151
        SYFTAWAGPGCNNHAARYSKCGCSNIGNNVHGGYEFMYQGQTAAAYNTDNCKGVAQTRFSSSVNQACSSFGWKSFFIQC
  • 3. L01A003091    From 1 To 76 E-value: 2e-22 Score: 95.9
        SAFTVWSGPGCNNRAERYSKCGCSAI--HQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSA-RACNPFGWKSIFIQC
  • 4. L13A028418    From 1 To 49 E-value: 0.000000000005 Score: 61.6
        SAFTVWSGPGCNNRAERYSKCGCSAI--HQKGGYDFSYTGQTAALYNQAGC
  • 5. L01A003277    From 1 To 15 E-value: 0.02 Score: 29.6
        FSGSVNQACSGFGWK

Structure

  •   Domains
  •   1  Name:Antimic/Inh_G_crystallin-like    Interpro Link:IPR015791
  •   2  Name:Antimicrobial_MiAMP1    Interpro Link:IPR015201
  •   3  Name:G_crystallin-rel    Interpro Link:IPR011024
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ekramoddoullah A.K.M.,Davidson J.,
  •   Title:Analysis of bark proteins in blister rust-resistant and susceptible western white pine (Pinus monticola).
  •   Journal:Tree Physiol., 1997, 17, 663-669  [PubMed:14759906]
  •   [2]  Zamani A.,Liu J.-J.,Ekramoddoullah A.K.M.,
  •   Title:Cloning and characterization of a putative antifungal peptide gene (Pm-AMP1) in Pinus monticola.
  •   Journal:Phytopathology, 2006, 96, 164-170  [PubMed:18943919]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: