Record in detail


General Info

  • lamp_id:L01A003279
  • Name:BLCI_BACIU
  • FullName:Antimicrobial peptide LCI
  • Source:Bacillus subtilis
  • Mass:5464.2 Da
  • Sequence Length:47 aa
  • Isoelectric Point:9.85
  • Activity:Antibacterial
  • Sequence
        AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK
  • Function:Has antibacterial activity against X.oryzae pv oryzae and R.solanacearum, but not E.coli or P.carotovorum subsp carotovorum. May bind DNA or mRNA.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003279    From 1 To 47 E-value: 1e-22 Score: 97.1
        AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK
  • 2. L12A07854|    From 49 To 94 E-value: 6e-21 Score: 91.3
        AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYESVDK
  • 3. L12A07849|    From 49 To 94 E-value: 6e-21 Score: 91.3
        AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYESVDK
  • 4. L12A07850|    From 49 To 94 E-value: 7e-21 Score: 90.9
        AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYESVDK
  • 5. L12A07851|    From 47 To 92 E-value: 8e-21 Score: 90.9
        AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYESVDK

Structure

  •   Domains
  •   1  Name:Antimicrobial_lci    Interpro Link:IPR020976
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Chen Z.-L.,Pan N.-S.,Liu J.-Y.,
  •   Title:Characterization of an anti-rice bacterial blight polypeptide LCI.
  •   Journal:Rice Genet. Newsl., 1990, 7, 151-154  [:]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: