Record in detail


General Info

  • lamp_id:L01A003282
  • Name:AP7_TITCO
  • FullName:Anionic peptide clone 7
  • Source:Tityus costatus
  • Mass:5847.1 Da
  • Sequence Length:50 aa
  • Isoelectric Point:2.6
  • Activity:Antimicrobial
  • Sequence
        YPTSYDDDFDALDDLDDLDLDDLLDLEPADLVLLDMWANMLDSQDFEDFE
  • Function:May be an antimicrobial peptide (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003282    From 1 To 50 E-value: 5e-20 Score: 88.2
        YPTSYDDDFDALDDLDDLDLDDLLDLEPADLVLLDMWANMLDSQDFEDFE
  • 2. L01A003283    From 1 To 50 E-value: 2e-19 Score: 86.3
        YPASYDDDFDALDDLDDLDLDDLLDLEPADLVLLDMWANMLDSQDFEDFE
  • 3. L01A003269    From 1 To 50 E-value: 0.000000000005 Score: 61.6
        YPASMDNYDDALEELDNLDLDDYFDLEPADFVLLDMWANMLESSDFDDME
  • 4. L01A003284    From 1 To 50 E-value: 0.00000002 Score: 49.7
        YPASYDDDFDALDDLDGLDLDDLLDSEPADLVLLDMWANMLDSQDFEDFE
  • 5. L01A003285    From 32 To 50 E-value: 0.00001 Score: 40
        VLLDMWANMLDSQDFEDFE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Candido D.M.,Lucas S.,Garcia-Gomez B.I.,Batista C.V.F.,Diego-Garcia E.,
  •   Title:The Brazilian scorpion Tityus costatus Karsch: genes, peptides and function.
  •   Journal:Toxicon, 2005, 45, 273-283  [PubMed:15683865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: