Record in detail
General Info
- lamp_id:L01A003301
- Name:SBOA_BACSU
- FullName:Subtilosin-A
- Source:Bacillus subtilis (strain 168)
- Mass:3425.9 Da
- Sequence Length:35 aa
- Isoelectric Point:3.88
- Activity:Antibacterial
- Sequence
NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG - Function:Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium.
Cross-Linking
- Cross-linking
- 1 Database:APD 928
- 2 Database:CAMP CAMPSQ3851
- 3 Database:DBAASP 6076
- 4 Database:dbAMP dbAMP_09719
- 5 Database:DRAMP DRAMP00167
- 6 Database:SATPdb satpdb25244
- 7 Database:Uniprot O07623
- 8 Database:BAC BAC054
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A07937| From 9 To 43 E-value: 0.000000000000002 Score: 72.8
NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG - 2. L01A003301 From 1 To 35 E-value: 0.000000000000004 Score: 71.6
NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG - 3. L13A018767 From 1 To 35 E-value: 0.00000000000002 Score: 69.7
NKGCAICSIGAACLVDGPIPDFEIAGATGLFGLWG - 4. L12A09720| From 1 To 35 E-value: 0.00000000000003 Score: 68.9
NKGCATCSIGAACLVDGPIPDFEIAGATGLXGLWG - 5. L12A12356| From 1 To 33 E-value: 0.0000000002 Score: 56.6
NKGCSACAIGAACLADGPIPDFEVAGITGTFGI
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Kurahashi K.,Shimonishi Y.,Takao T.,Babasaki K.,
- Title:Subtilosin A, a new antibiotic peptide produced by Bacillus subtilis 168: isolation, structural analysis, and biogenesis.
- Journal:J. Biochem., 1985, 98, 585-603 [MEDLINE:86111663]
- [2] De La Fuente V.,Cruz Ramos H.,Boursier L.,Moszer I.,Presecan E.,
- Title:The Bacillus subtilis genome from gerBC (311 degrees) to licR (334 degrees).
- Journal:Microbiology, 1997, 143, 3313-3328 [MEDLINE:98015417]
- [3] Alloni G.,Albertini A.M.,Moszer I.,Ogasawara N.,Kunst F.,
- Title:The complete genome sequence of the Gram-positive bacterium Bacillus subtilis.
- Journal:Nature, 1997, 390, 249-256 [MEDLINE:98044033]
- [4] Zuber P.,Vederas J.C.,Yan L.Z.,Zheng G.,
- Title:Genes of the sbo-alb locus of Bacillus subtilis are required for production of the antilisterial bacteriocin subtilosin.
- Journal:J. Bacteriol., 1999, 181, 7346-7355 [MEDLINE:20042357]
- [5] Zuber P.,Zheng G.,Nakano M.M.,
- Title:Dual control of sbo-alb operon expression by the Spo0 and ResDE systems of signal transduction under anaerobic conditions in Bacillus subtilis.
- Journal:J. Bacteriol., 2000, 182, 3274-3277 [MEDLINE:20270160]
- [6] Diaper C.M.,Mercier P.,McKay R.T.,Sprules T.,Kawulka K.,
- Title:Structure of subtilosin A, an antimicrobial peptide from Bacillus subtilis with unusual posttranslational modifications linking cysteine sulfurs to alpha-carbons of phenylalanine and threonine.
- Journal:J. Am. Chem. Soc., 2003, 125, 4726-4727 [MEDLINE:22583854]
Comments
- Comments
No comments found on LAMP database