Record in detail


General Info

  • lamp_id:L01A003316
  • Name:ES1VB_RANVE
  • FullName:Esculentin-1Vb
  • Source:Rana versabilis
  • Mass:4939.9 Da
  • Sequence Length:46 aa
  • Isoelectric Point:10.5
  • Activity:Antimicrobial
  • Sequence
        GIFTKINKKKAKTGVFNIIKTIGKEAGMDVIRAGIDTISCKIKGEC
  • Function:Antimicrobial peptide (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003316    From 1 To 46 E-value: 5e-20 Score: 88.2
        GIFTKINKKKAKTGVFNIIKTIGKEAGMDVIRAGIDTISCKIKGEC
  • 2. L02A001272    From 1 To 46 E-value: 2e-19 Score: 85.9
        GIFSKINKKKAKTGLFNIIKTVGKEAGMDVIRAGIDTISCKIKGEC
  • 3. L02A000649    From 1 To 46 E-value: 8e-18 Score: 80.9
        GLFPKINKKKAKTGVFNIIKTVGKEAGMDLIRTGIDTIGCKIKGEC
  • 4. L02A001273    From 1 To 46 E-value: 8e-16 Score: 73.9
        GLFPKFNKKKVKTGIFDIIKTVGKEAGMDVLRTGIDVIGCKIKGEC
  • 5. L01A000107    From 1 To 46 E-value: 0.0000000000002 Score: 66.2
        GLFSKFNKKKIKSGLFKIIKTAGKEAGLEALRTGIDVIGCKIKGEC

Structure

  •   Domains
  •   1  Name:Antimicrobial_frog_2    Interpro Link:IPR012521
  •   2  Name:Brevinin    Interpro Link:IPR004275
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  MIC:  4.9399 μg/ml  (1 μM)  
  •   2  Target:  S. aureus  MIC:  74.0985 μg/ml  (15 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Shaw C.,Walker B.,Rao P.,Zhou M.,Chen T.,
  •   Title:The Chinese bamboo leaf odorous frog (Rana (odorrana) versabilis) and north american rana frogs share the same families of skin antimicrobial peptides.
  •   Journal:Peptides, 2006, 27, 1738-1744  [PubMed:16621152]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: