Record in detail


General Info

  • lamp_id:L01A003326
  • Name:TACB2_TACTR
  • FullName:Tachystatin-B2
  • Source:Tachypleus tridentatus
  • Mass:4946.6 Da
  • Sequence Length:42 aa
  • Isoelectric Point:9.45
  • Activity:Antibacterial
  • Sequence
        YITCLFRGARCRVYSGRSCCFGYYCRRDFPGSIFGTCSRRNF
  • Function:Exhibits stronger antimicrobial activity against the Gram-positive bacteria (S.aureus (IC(50) is 7.4 ug/ml)) and fungi (C.albicans (IC(50) is 3.0 ug/ml) and P.pastoris (IC(50) is 0.1 ug/ml)) than Gram-negative bacteria (E.coli no inhibition at 100 ug/ml). Binds to chitin (4.3 uM are required to obtain 50% of binding). Does not cause hemolysis on sheep erythrocytes. Has no blocking activity on the P-type calcium channel.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003326    From 1 To 42 E-value: 2e-18 Score: 83.2
        YITCLFRGARCRVYSGRSCCFGYYCRRDFPGSIFGTCSRRNF
  • 2. L01A002991    From 1 To 42 E-value: 5e-18 Score: 81.6
        YVSCLFRGARCRVYSGRSCCFGYYCRRDFPGSIFGTCSRRNF
  • 3. L03A000353    From 1 To 42 E-value: 5e-17 Score: 78.2
        YVSCLFRGARCEVYSGRSCCFGYYCRRDFPGSYFGTCSRRNF
  • 4. L03A000161    From 24 To 66 E-value: 0.13 Score: 26.9
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQR
  • 5. L12A08087|    From 24 To 66 E-value: 0.13 Score: 26.9
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQR

Structure

  •   Domains
  •   1  Name:Tachystatin_B    Interpro Link:IPR020957
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  S.aureus  IC50:  7.4 μg/ml  (1.49598 μM)  
  •   2  Target:  P.pastoris  IC50:  0.1 μg/ml  (0.0202159 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Iwanaga S.,Hirata M.,Nagayama R.,Omotezako M.,Osaki T.,
  •   Title:Horseshoe crab hemocyte-derived antimicrobial polypeptides, tachystatins, with sequence similarity to spider neurotoxins.
  •   Journal:J. Biol. Chem., 1999, 274, 26172-26178  [MEDLINE:99403058]
  •   [2]  Osaki T.,Takaya K.,Nakahara T.,Kouno T.,Fujitani N.,
  •   Title:The solution structure of horseshoe crab antimicrobial peptide tachystatin B with an inhibitory cystine-knot motif.
  •   Journal:J. Pept. Sci., 2007, 13, 269-279  [PubMed:17394123]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: