Record in detail


General Info

  • lamp_id:L01A003347
  • Name:ES2R_PELRI
  • FullName:Esculentin-2R
  • Source:Pelophylax ridibundus
  • Mass:3770.5 Da
  • Sequence Length:36 aa
  • Isoelectric Point:10.14
  • Activity:Antimicrobial
  • Sequence
        GILSLVKVAKLAGKTFAKEGGKFGLEFIACKVTNQC
  • Function:Antimicrobial peptide (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003347    From 1 To 36 E-value: 0.000000000000008 Score: 70.9
        GILSLVKVAKLAGKTFAKEGGKFGLEFIACKVTNQC
  • 2. L01A003349    From 1 To 37 E-value: 0.0000000003 Score: 55.5
        GILSLVKGAAKLLGKGLAKEGGKVGLEFIACKVTNQC
  • 3. L01A000646    From 1 To 37 E-value: 0.0000000005 Score: 55.1
        GILSLVKGVAKLAGKGLAKEGGKFGLELIACKIAKQC
  • 4. L01A003348    From 1 To 37 E-value: 0.000000005 Score: 51.6
        GIFSLVKGVAKLAGKTLAKEGGKFGLELAMCKIAKQC
  • 5. L01A000647    From 1 To 37 E-value: 0.000000006 Score: 51.2
        GIFSLVKGAAKLAGKGLAKEGGKFGLELIACKIAKQC

Structure

  •   Domains
  •   1  Name:Antimicrobial_frog_2    Interpro Link:IPR012521
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zubarev R.A.,Ogourtsov S.V.,Gorshkov V.A.,Artemenko K.A.,Samgina T.Y.,
  •   Title:De novo sequencing of peptides secreted by the skin glands of the caucasian green frog Rana ridibunda.
  •   Journal:Rapid Commun. Mass Spectrom., 2008, 22, 3517-3525  [PubMed:18855342]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: