Record in detail
General Info
- lamp_id:L01A003347
- Name:ES2R_PELRI
- FullName:Esculentin-2R
- Source:Pelophylax ridibundus
- Mass:3770.5 Da
- Sequence Length:36 aa
- Isoelectric Point:10.14
- Activity:Antimicrobial
- Sequence
GILSLVKVAKLAGKTFAKEGGKFGLEFIACKVTNQC - Function:Antimicrobial peptide (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1788
- 2 Database:dbAMP dbAMP_03087
- 3 Database:DRAMP DRAMP01466
- 4 Database:SATPdb satpdb19330
- 5 Database:Uniprot P86016
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003347 From 1 To 36 E-value: 0.000000000000008 Score: 70.9
GILSLVKVAKLAGKTFAKEGGKFGLEFIACKVTNQC - 2. L01A003349 From 1 To 37 E-value: 0.0000000003 Score: 55.5
GILSLVKGAAKLLGKGLAKEGGKVGLEFIACKVTNQC - 3. L01A000646 From 1 To 37 E-value: 0.0000000005 Score: 55.1
GILSLVKGVAKLAGKGLAKEGGKFGLELIACKIAKQC - 4. L01A003348 From 1 To 37 E-value: 0.000000005 Score: 51.6
GIFSLVKGVAKLAGKTLAKEGGKFGLELAMCKIAKQC - 5. L01A000647 From 1 To 37 E-value: 0.000000006 Score: 51.2
GIFSLVKGAAKLAGKGLAKEGGKFGLELIACKIAKQC
Structure
- Domains
- 1 Name:Antimicrobial_frog_2 Interpro Link:IPR012521
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Zubarev R.A.,Ogourtsov S.V.,Gorshkov V.A.,Artemenko K.A.,Samgina T.Y.,
- Title:De novo sequencing of peptides secreted by the skin glands of the caucasian green frog Rana ridibunda.
- Journal:Rapid Commun. Mass Spectrom., 2008, 22, 3517-3525 [PubMed:18855342]
Comments
- Comments
No comments found on LAMP database