Record in detail
General Info
- lamp_id:L01A003348
- Name:ES2RB_PELRI
- FullName:Esculentin-2Rb
- Source:Pelophylax ridibundus
- Mass:3809.7 Da
- Sequence Length:37 aa
- Isoelectric Point:10.41
- Activity:Antimicrobial
- Sequence
GIFSLVKGVAKLAGKTLAKEGGKFGLELAMCKIAKQC - Function:Antimicrobial peptide (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1789
- 2 Database:dbAMP dbAMP_02869
- 3 Database:DRAMP DRAMP01467
- 4 Database:SATPdb satpdb26552
- 5 Database:Uniprot P86021
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003348 From 1 To 37 E-value: 0.000000000000008 Score: 70.9
GIFSLVKGVAKLAGKTLAKEGGKFGLELAMCKIAKQC - 2. L01A000647 From 1 To 37 E-value: 0.000000000005 Score: 61.2
GIFSLVKGAAKLAGKGLAKEGGKFGLELIACKIAKQC - 3. L01A000646 From 1 To 37 E-value: 0.000000000007 Score: 60.8
GILSLVKGVAKLAGKGLAKEGGKFGLELIACKIAKQC - 4. L01A003369 From 1 To 37 E-value: 0.000000001 Score: 53.1
GIFSLIKGAAQLIGKTVAKEAGKTGLELMACKVTKQC - 5. L02A001866 From 1 To 37 E-value: 0.000000002 Score: 52.8
GIFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC
Structure
- Domains
- 1 Name:Antimicrobial_frog_2 Interpro Link:IPR012521
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Zubarev R.A.,Ogourtsov S.V.,Gorshkov V.A.,Artemenko K.A.,Samgina T.Y.,
- Title:De novo sequencing of peptides secreted by the skin glands of the caucasian green frog Rana ridibunda.
- Journal:Rapid Commun. Mass Spectrom., 2008, 22, 3517-3525 [PubMed:18855342]
Comments
- Comments
No comments found on LAMP database