Record in detail
General Info
- lamp_id:L01A003349
- Name:ES2RA_PELRI
- FullName:Esculentin-2Ra
- Source:Pelophylax ridibundus
- Mass:3715.5 Da
- Sequence Length:37 aa
- Isoelectric Point:10.14
- Activity:Antimicrobial
- Sequence
GILSLVKGAAKLLGKGLAKEGGKVGLEFIACKVTNQC - Function:Antimicrobial peptide (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1790
- 2 Database:dbAMP dbAMP_03085
- 3 Database:DRAMP DRAMP01468
- 4 Database:SATPdb satpdb28560
- 5 Database:Uniprot P86017
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003349 From 1 To 37 E-value: 0.00000000000001 Score: 70.1
GILSLVKGAAKLLGKGLAKEGGKVGLEFIACKVTNQC - 2. L12A07368| From 42 To 78 E-value: 0.00000000003 Score: 59.3
GIFTLFKGAAKLLGKTLAKEAGKTGLELMACKVTNQC - 3. L12A07126| From 42 To 78 E-value: 0.00000000003 Score: 58.9
GIFTLFKGAAKLLGKTLAKEAGKTGLELMACKVTNQC - 4. L13A026413 From 1 To 37 E-value: 0.00000000005 Score: 58.2
GLFTLIKGAAKLIGKTVAKEAGKTGLEFMACKITNQC - 5. L10Q1MU180 From 1 To 37 E-value: 0.00000000005 Score: 58.2
GIFTLFKGAAKLLGKTLAKEAGKTGLELMACKVTNQC
Structure
- Domains
- 1 Name:Antimicrobial_frog_2 Interpro Link:IPR012521
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Zubarev R.A.,Ogourtsov S.V.,Gorshkov V.A.,Artemenko K.A.,Samgina T.Y.,
- Title:De novo sequencing of peptides secreted by the skin glands of the caucasian green frog Rana ridibunda.
- Journal:Rapid Commun. Mass Spectrom., 2008, 22, 3517-3525 [PubMed:18855342]
Comments
- Comments
No comments found on LAMP database