Record in detail


General Info

  • lamp_id:L01A003362
  • Name:SPG11_RAT
  • FullName:Sperm-associated antigen 11
  • Source:Rattus norvegicus
  • Mass:5631.5 Da
  • Sequence Length:49 aa
  • Isoelectric Point:8.91
  • Activity:Antibacterial
  • Sequence
        DIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR
  • Function:Antimicrobial peptide against E.coli. Is also responsible for sperm maturation, storage, and protection.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000186    From 20 To 68 E-value: 6e-25 Score: 104
        DIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR
  • 2. L01A003362    From 1 To 49 E-value: 2e-24 Score: 102
        DIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR
  • 3. L01A003450    From 3 To 51 E-value: 7e-22 Score: 94.4
        DIPPGIRNTVCLMQQGHCRLFMCRSGERKGDICSDPWNRCCVPYSVKDR
  • 4. L02A001592    From 1 To 45 E-value: 8e-22 Score: 94
        GIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR
  • 5. L13A012265    From 3 To 50 E-value: 2e-21 Score: 92.8
        DIPPGIRNTVCLMQQGHCRLFMCRSGERKGDICSDPWNRCCVPYSVKD

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Chung Y.W.,So S.C.,He B.,Chan H.C.,Li P.,
  •   Title:An antimicrobial peptide gene found in the male reproductive system of rats.
  •   Journal:Science, 2001, 291, 1783-1785  [PubMed:11230693]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: