Record in detail


General Info

  • lamp_id:L01A003369
  • Name:ES2HA_RANHO
  • FullName:Esculentin-2HSa
  • Source:Rana hosii
  • Mass:3807.6 Da
  • Sequence Length:37 aa
  • Isoelectric Point:10.14
  • Activity:Antibacterial
  • Sequence
        GIFSLIKGAAQLIGKTVAKEAGKTGLELMACKVTKQC
  • Function:Has antibacterial activity against the Gram-positive bacterium S.aureus ATCC 25923 (MIC=32uM) and the Gram-negative bacterium E.coli ATCC 25726 (MIC=16uM).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003369    From 1 To 37 E-value: 0.000000000000003 Score: 72
        GIFSLIKGAAQLIGKTVAKEAGKTGLELMACKVTKQC
  • 2. L12A07355|    From 42 To 78 E-value: 0.00000000000008 Score: 67.4
        GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC
  • 3. L02A001866    From 1 To 37 E-value: 0.00000000000009 Score: 67.4
        GIFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC
  • 4. L12A07135|    From 42 To 78 E-value: 0.00000000000009 Score: 67.4
        GIFSLIKGAAKLITKTVAKEAGKTGLELMACKVTNQC
  • 5. L12A07340|    From 42 To 78 E-value: 0.0000000000001 Score: 67
        GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITHQC

Structure

  •   Domains
  •   1  Name:Antimicrobial_frog_2    Interpro Link:IPR012521
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  S.aureus ATCC 25923  MIC:  121.84 μg/ml  (31.9992 μM)  
  •   2  Target:  E.coli ATCC 25726  MIC:  60.92 μg/ml  (15.9996 μM)  
  •   3  Target:  E. coli  MIC:  60.9216 μg/ml  (16 μM)  
  •   4  Target:  S. aureus  MIC:  121.843 μg/ml  (32 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Vaudry H.,Leprince J.,Nowotny N.,Kolodziejek J.,Conlon J.M.,
  •   Title:Characterization of antimicrobial peptides from the skin secretions of the Malaysian frogs, Odorrana hosii and Hylarana picturata (Anura:Ranidae).
  •   Journal:Toxicon, 2008, 52, 465-473  [PubMed:18621071]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: