Record in detail


General Info

  • lamp_id:L01A003375
  • Name:GLL5_CHICK
  • FullName:Gallinacin-5
  • Source:Gallus gallus
  • Mass:4593.2 Da
  • Sequence Length:41 aa
  • Isoelectric Point:8.39
  • Activity:Antibacterial
  • Sequence
        GLPQDCERRGGFCSHKSCPPGIGRIGLCSKEDFCCRSRWYS
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08937|    From 26 To 66 E-value: 3e-20 Score: 88.6
        GLPQDCERRGGFCSHKSCPPGIGRIGLCSKEDFCCRSRWYS
  • 2. L01A003375    From 1 To 41 E-value: 3e-19 Score: 85.5
        GLPQDCERRGGFCSHKSCPPGIGRIGLCSKEDFCCRSRWYS
  • 3. L12A10054|    From 1 To 33 E-value: 0.0000000004 Score: 55.1
        QDCERRGGFCPHSSCPTGIRRIGLCSEQVFCCR
  • 4. L12A09054|    From 26 To 64 E-value: 0.006 Score: 31.6
        GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIW
  • 5. L01A000658    From 1 To 39 E-value: 0.006 Score: 31.2
        GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIW

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Cheng J.-F.,Matsuda Y.,Ando J.,Hughes A.L.,Xiao Y.,
  •   Title:A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.
  •   Journal:BMC Genomics, 2004, 5, 56-56  [PubMed:15310403]
  •   [2]  James T.,Tierney J.,Gaines S.,Higgs R.,Lynn D.J.,
  •   Title:Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.
  •   Journal:Immunogenetics, 2004, 56, 170-177  [PubMed:15148642]
  •   [3]  Yoshimura Y.,Nishibori M.,Isobe N.,Subedi K.,
  •   Title:Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).
  •   Journal:Reproduction, 2007, 133, 127-133  [PubMed:17244739]
  •   [4]  Hall J.,Bevan R.M.,Townes C.L.,Milona P.,
  •   Title:The chicken host peptides, gallinacins 4, 7, and 9 have antimicrobial activity against Salmonella serovars.
  •   Journal:Biochem. Biophys. Res. Commun., 2007, 356, 169-174  [PubMed:17346671]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: