Record in detail


General Info

  • lamp_id:L01A003377
  • Name:CTHB1_CHICK
  • FullName:Cathelicidin-B1
  • Source:Gallus gallus
  • Mass:5028.8 Da
  • Sequence Length:40 aa
  • Isoelectric Point:12.63
  • Activity:Antibacterial
  • Sequence
        PIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQP
  • Function:Has potent antimicrobial activity against Gram-positive and Gram-negative bacteria (in vitro). May play a role in the innate immune response.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003377    From 1 To 40 E-value: 2e-18 Score: 82.4
        PIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQP

Structure

  •   Domains
  •   1  Name:Cathelicidin    Interpro Link:IPR001894
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  MIC:  12.57 μg/ml  (2.4996 μM)  
  •   2  Target:  S. aureus  MIC:  6.29 μg/ml  (1.2508 μM)  
  •   3  Target:  P. aeruginosa  MIC:  3.17 μg/ml  (0.630369 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zaim J.,Bezzubov Y.,Arakawa H.,Kierzek A.M.,Caldwell R.B.,
  •   Title:Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis.
  •   Journal:Genome Biol., 2005, 6, 0-0  [PubMed:15642098]
  •   [2]  Kitamura D.,Asano Y.,Benyon L.,Chen C.-I.H.,Goitsuka R.,
  •   Title:Chicken cathelicidin-B1, an antimicrobial guardian at the mucosal M cell gateway.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 2007, 104, 15063-15068  [PubMed:17827276]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: