Record in detail


General Info

  • lamp_id:L01A003387
  • Name:CTX11_LACTA
  • FullName:M-zodatoxin-Lt8a
  • Source:Lachesana tarabaevi
  • Mass:7905.6 Da
  • Sequence Length:69 aa
  • Isoelectric Point:10.88
  • Activity:Antibacterial
  • Sequence
        GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYLLKYYGKKALQKASEKL
  • Function:Insecticidal, cytolytic and antimicrobial peptide. Has insecticidal activity against the flesh fly S.carnaria, and against the cockroach N.cinerea. Has hemolytic activity against human erythrocytes (EC(50)=6 uM). Has cytolytic activity against insect Sf9 cells (EC(50)=1 uM) and human leukocytes (EC(50)=3 uM). Has antibacterial activity against the Gram-positive bacteria A.globiformis VKM Ac-1112 (MIC=0.5 uM), and B.subtilis VKM B-501 (MIC=0.9 uM), and against the Gram-negative bacteria E.coli C600 (MIC=0.5 uM), E.coli DH5alpha (MIC=0.9 uM), E.coli MH1 (MIC=0.5 uM), P.aeruginosa PAO1 (MIC=1.9 uM), and P.fluorescens VKM B-894 (MIC=3.8 uM). Lacks antimicrobial activity against the Gram-positive bacteria M.luteus and S.aureus, and against the Gram-negative bacterium S.marcescens. Forms voltage-dependent, ion-permeable channels in membranes. At high concentration causes cell membrane lysis.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003387    From 1 To 69 E-value: 6e-33 Score: 130
        GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYLLKYYGKKALQKASEKL
  • 2. L01A003432    From 1 To 69 E-value: 1e-32 Score: 130
        GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGITKEEAQAKVDAMSKKQIRLYLLKYYGKKALQKASEKL
  • 3. L01A003431    From 1 To 69 E-value: 1e-32 Score: 130
        GFFGNTWKKIKGKSDKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYLLKYYGKKALQKASEKL
  • 4. L01A003434    From 1 To 69 E-value: 1e-32 Score: 130
        GFFGNTWKKIKGKADKIMLKKAVKLMVKKEGISKEEAQAKVDAMSKKQIRLYLLKYYGKKALQKASEKL
  • 5. L01A003430    From 1 To 69 E-value: 1e-32 Score: 129
        GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYLLKHYGKKALQKASEKL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  A. globiformisVKM Ac-1112  MIC:  3.95 μg/ml  (0.499646 μM)  
  •   2  Target:  B.subtilis VKM B-501  MIC:  7.12 μg/ml  (0.900627 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Karpunin D.V.,Egorova N.S.,Samsonova O.V.,Kozlov S.A.,Vassilevski A.A.,
  •   Title:Cyto-insectotoxins, a novel class of cytolytic and insecticidal peptides from spider venom.
  •   Journal:Biochem. J., 2008, 411, 687-696  [PubMed:18215128]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: