Record in detail
General Info
- lamp_id:L01A003394
- Name:DRG1_PHYBI
- FullName:Dermaseptin DRG1
- Source:Phyllomedusa bicolor
- Mass:3153.6 Da
- Sequence Length:33 aa
- Isoelectric Point:10.63
- Activity:Antimicrobial
- Sequence
GLWSNIKTAGKEAAKAALKAAGKAALGAVTDAV - Function:Has antimicrobial activity (Potential).
Cross-Linking
- Cross-linking
- 1 Database:APD 936
- 2 Database:CAMP CAMPSQ1821
- 3 Database:dbAMP dbAMP_03854
- 4 Database:DRAMP DRAMP01655
- 5 Database:SATPdb satpdb12078
- 6 Database:Uniprot Q90ZK3
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003394 From 1 To 33 E-value: 0.00000000002 Score: 59.7
GLWSNIKTAGKEAAKAALKAAGKAALGAVTDAV - 2. L02A000937 From 1 To 29 E-value: 0.00004 Score: 38.9
GLWSKIK----EAGKAVLTAAGKAALGAVSDAV - 3. L03A000083 From 46 To 77 E-value: 0.0006 Score: 34.7
GMWSTIRNVGKSAAKAA-NLPAKAALGAISEAV - 4. L01A002844 From 1 To 32 E-value: 0.001 Score: 33.9
GMWSTIRNVGKSAAKAA-NLPAKAALGAISEAV - 5. L12A05358| From 41 To 67 E-value: 0.006 Score: 31.2
GLWSTIKNVGKEAA----IAAGKAVLGSLGE
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database