Record in detail


General Info

  • lamp_id:L01A003405
  • Name:DEFB5_ORNAN
  • FullName:Defensin-B5
  • Source:Ornithorhynchus anatinus
  • Mass:3625.2 Da
  • Sequence Length:32 aa
  • Isoelectric Point:8.64
  • Activity:Antimicrobial
  • Sequence
        KKCRERGGQCHSGVCSWNEKFIGFCSFARPCC
  • Function:Has antimicrobial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003405    From 1 To 32 E-value: 0.00000000000008 Score: 67.4
        KKCRERGGQCHSGVCSWNEKFIGFCSFARPCC
  • 2. L13A022686    From 16 To 45 E-value: 0.003 Score: 32.3
        CRIRGGRCHVGSCHFPERHIGRCSGFQACC
  • 3. L01A003113    From 7 To 37 E-value: 0.006 Score: 31.6
        QCRQVGGYCGLRICNFPSRFLGLCTRNHPCC
  • 4. L12A05395|    From 30 To 60 E-value: 0.018 Score: 29.6
        DCGSNGGSCVSGFCPYGNRLNYFCSLGRTCC
  • 5. L05ADEF521    From 8 To 39 E-value: 0.078 Score: 27.7
        NDCGSNGGSCTRGYCSYSNRLPYTCSLGRTCC

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wong E.S.,Torres A.M.,Bansal P.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Defensins and the convergent evolution of platypus and reptile venom genes.
  •   Journal:Genome Res., 2008, 18, 986-994  [PubMed:18463304]
  •   [2]  Belov K.,Kuchel P.W.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Expression patterns of platypus defensin and related venom genes across a range of tissue types reveal the possibility of broader functions for OvDLPs than previously suspected.
  •   Journal:Toxicon, 2008, 52, 559-565  [PubMed:18662710]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: