Record in detail


General Info

  • lamp_id:L01A003408
  • Name:DEFB1_ORNAN
  • FullName:Defensin-B1
  • Source:Ornithorhynchus anatinus
  • Mass:3931.6 Da
  • Sequence Length:35 aa
  • Isoelectric Point:8.38
  • Activity:Antimicrobial
  • Sequence
        GMKEKCVTMGGYCRKQCRVQDALSGYCRNENPCCV
  • Function:Has antimicrobial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003408    From 1 To 35 E-value: 9e-16 Score: 73.9
        GMKEKCVTMGGYCRKQCRVQDALSGYCRNENPCCV
  • 2. L01A003407    From 1 To 35 E-value: 0.0002 Score: 36.6
        GLNNKCAYFRGQCRRKCPQRDIFFGFCRNHDQCCL
  • 3. L01A003498    From 3 To 37 E-value: 0.001 Score: 33.9
        GGEKKCWNRSGHCRKQCKDGEAVKETCKNHRACCV
  • 4. L12A11539|    From 36 To 70 E-value: 0.002 Score: 33.1
        GTWEKCWNLLGKCRHTCFKKERIYVYCTNSKPCCV
  • 5. L01A003497    From 5 To 37 E-value: 0.004 Score: 32
        EKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wong E.S.,Torres A.M.,Bansal P.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Defensins and the convergent evolution of platypus and reptile venom genes.
  •   Journal:Genome Res., 2008, 18, 986-994  [PubMed:18463304]
  •   [2]  Belov K.,Kuchel P.W.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Expression patterns of platypus defensin and related venom genes across a range of tissue types reveal the possibility of broader functions for OvDLPs than previously suspected.
  •   Journal:Toxicon, 2008, 52, 559-565  [PubMed:18662710]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: