Record in detail


General Info

  • lamp_id:L01A003411
  • Name:DEFA2_ORNAN
  • FullName:Defensin-A2
  • Source:Ornithorhynchus anatinus
  • Mass:3645.2 Da
  • Sequence Length:32 aa
  • Isoelectric Point:8.5
  • Activity:Antimicrobial
  • Sequence
        STITCYCRSRCRMLEKNSGTCRSSNCTYTLCC
  • Function:Has antimicrobial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003411    From 1 To 32 E-value: 0.000000000003 Score: 62.4
        STITCYCRSRCRMLEKNSGTCRSSNCTYTLCC
  • 2. L12A07796|    From 25 To 56 E-value: 0.00002 Score: 39.7
        SGVTCYCRISCQFGERLSGSCRSGGVTYPLCC
  • 3. L03A000178    From 62 To 92 E-value: 0.0004 Score: 35
        LVCYCRSRGCKGRERMNGTCRKGHLMYTLCC
  • 4. L03A000156    From 62 To 92 E-value: 0.0005 Score: 35
        LVCYCRSRGCKGRERMNGTCRKGHLLYTLCC
  • 5. L05ADEF374    From 63 To 95 E-value: 0.0006 Score: 34.7
        SGVTCYCRLLSCQFGERLAGSCRSGGVTYPLCC

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wong E.S.,Torres A.M.,Bansal P.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Defensins and the convergent evolution of platypus and reptile venom genes.
  •   Journal:Genome Res., 2008, 18, 986-994  [PubMed:18463304]
  •   [2]  Belov K.,Kuchel P.W.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Expression patterns of platypus defensin and related venom genes across a range of tissue types reveal the possibility of broader functions for OvDLPs than previously suspected.
  •   Journal:Toxicon, 2008, 52, 559-565  [PubMed:18662710]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: