Record in detail


General Info

  • lamp_id:L01A003415
  • Name:GLL10_CHICK
  • FullName:Gallinacin-10
  • Source:Gallus gallus
  • Mass:4456.1 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.12
  • Activity:Antibacterial
  • Sequence
        FPDTVACRTQGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003415    From 1 To 43 E-value: 2e-20 Score: 89.7
        FPDTVACRTQGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ
  • 2. L02A001147    From 1 To 41 E-value: 1e-18 Score: 83.6
        DTVACRIQGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ
  • 3. L02A001549    From 17 To 55 E-value: 0.000000000000003 Score: 72.4
        FADTAACRSQGNFCRAGACPPTFAASGSCHGGLLNCCAK
  • 4. L13A023497    From 17 To 50 E-value: 0.000000000003 Score: 62.4
        FADTAACRSQGNFCRAGACPPTFAASGSCHGGLL
  • 5. L05ADEF187    From 25 To 61 E-value: 0.008 Score: 30.8
        DTIACIENKDTCRLKNCPRLHNVVGTCYEGKGKCCHK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Cheng J.-F.,Matsuda Y.,Ando J.,Hughes A.L.,Xiao Y.,
  •   Title:A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.
  •   Journal:BMC Genomics, 2004, 5, 56-56  [PubMed:15310403]
  •   [2]  James T.,Tierney J.,Gaines S.,Higgs R.,Lynn D.J.,
  •   Title:Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.
  •   Journal:Immunogenetics, 2004, 56, 170-177  [PubMed:15148642]
  •   [3]  Yoshimura Y.,Nishibori M.,Isobe N.,Subedi K.,
  •   Title:Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).
  •   Journal:Reproduction, 2007, 133, 127-133  [PubMed:17244739]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: