Record in detail


General Info

  • lamp_id:L01A003417
  • Name:DEF1_PANTR
  • FullName:Neutrophil defensin 1
  • Source:Pan troglodytes
  • Mass:3448 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.37
  • Activity:Antibacterial, Antifungal, Antiviral
  • Sequence
        ACYCRIPACLAGERRYGTCIYQGRLWAFCC
  • Function:Has antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000277    From 65 To 94 E-value: 0.0000000000002 Score: 66.2
        ACYCRIPACIAGERRYGTCIYQGRLWAFCC
  • 2. L12A09210|    From 65 To 94 E-value: 0.0000000000002 Score: 66.2
        ACYCRIPACIAGERRYGTCIYQGRLWAFCC
  • 3. L12A09209|    From 66 To 94 E-value: 0.0000000000004 Score: 65.1
        CYCRIPACIAGERRYGTCIYQGRLWAFCC
  • 4. L12A09208|    From 66 To 94 E-value: 0.0000000000004 Score: 65.1
        CYCRIPACIAGERRYGTCIYQGRLWAFCC
  • 5. L12A01083|    From 27 To 56 E-value: 0.0000000000008 Score: 64.3
        ACYCRIPACIAGERRYGTCIYQGRLWAFCC

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Hughes A.L.,Patil A.,
  •   Title:Rapid evolution and diversification of mammalian alpha-defensins as revealed by comparative analysis of rodent and primate genes.
  •   Journal:Physiol. Genomics, 2004, 20, 1-11  [PubMed:15494476]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: