Record in detail


General Info

  • lamp_id:L01A003418
  • Name:DEF6_PANTR
  • FullName:Defensin-6
  • Source:Pan troglodytes
  • Mass:4058.6 Da
  • Sequence Length:35 aa
  • Isoelectric Point:8.38
  • Activity:Antibacterial
  • Sequence
        STRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
  • Function:Has very low antimicrobial activity against Gram-negative and Gram-positive bacteria (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003418    From 1 To 35 E-value: 0.000000000000003 Score: 72.4
        STRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
  • 2. L01A002712    From 1 To 32 E-value: 0.00000000000009 Score: 67.4
        AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
  • 3. L13A011306    From 1 To 31 E-value: 0.0000000000004 Score: 65.5
        AFTCHCRRSCYSTEYSYGTCTVMGINHRFCC
  • 4. L12A00192|    From 1 To 32 E-value: 0.0000000000006 Score: 64.7
        AFTCHCRRSCYSTEYSYGTCTVMGINWRFCCL
  • 5. L12A09221|    From 61 To 93 E-value: 0.0005 Score: 34.7
        KTIICHCRRLLCLSSEHLSGICTIKGVRYPFCC

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Hughes A.L.,Patil A.,
  •   Title:Rapid evolution and diversification of mammalian alpha-defensins as revealed by comparative analysis of rodent and primate genes.
  •   Journal:Physiol. Genomics, 2004, 20, 1-11  [PubMed:15494476]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: