Record in detail


General Info

  • lamp_id:L01A003419
  • Name:DEF5_RAT
  • FullName:Defensin 5
  • Source:Rattus norvegicus
  • Mass:4094.9 Da
  • Sequence Length:35 aa
  • Isoelectric Point:9.62
  • Activity:Antimicrobial
  • Sequence
        LRDLKCFCRRKSCNWGEGIMGICKKRYGSPILCCR
  • Function:Probably contributes to the antimicrobial barrier function of the small intestine.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000159    From 59 To 93 E-value: 8e-17 Score: 77.4
        LRDLKCFCRRKSCNWGEGIMGICKKRYGSPILCCR
  • 2. L01A003419    From 1 To 35 E-value: 0.000000000000003 Score: 72.4
        LRDLKCFCRRKSCNWGEGIMGICKKRYGSPILCCR
  • 3. L05ADEF190    From 59 To 93 E-value: 0.00000000000003 Score: 68.9
        LRDLKCFCRAKSCNWGEGIMGICNKRYGSLILCCR
  • 4. L05ADEF375    From 59 To 93 E-value: 0.00000000000003 Score: 68.9
        LRDLKCFCRAKSCNWGEGIMGICNKRYGSLILCCR
  • 5. L05ADEF373    From 59 To 93 E-value: 0.0000000000001 Score: 66.6
        LRDLKCFCRAKSCNWGEGIMGICNKRYGMLILCCR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Diamond G.,D"Alessio M.,Viera A.,Condon M.R.,
  •   Title:Induction of a rat enteric defensin gene by hemorrhagic shock.
  •   Journal:Infect. Immun., 1999, 67, 4787-4793  [MEDLINE:99386878]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: