Record in detail


General Info

  • lamp_id:L01A003449
  • Name:D103A_HORSE
  • FullName:Beta-defensin 103A
  • Source:Equus caballus
  • Mass:5016.1 Da
  • Sequence Length:45 aa
  • Isoelectric Point:10.43
  • Activity:Antibacterial
  • Sequence
        GIINMLQKSYCKIRKGRCALLGCLPKEEQIGSCSVSGRKCCRKKK
  • Function:Exhibits antimicrobial activity against Gram-positive and Gram-negative bacteria (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003449    From 1 To 45 E-value: 5e-20 Score: 87.8
        GIINMLQKSYCKIRKGRCALLGCLPKEEQIGSCSVSGRKCCRKKK
  • 2. L03A000245    From 23 To 67 E-value: 0.000000000000002 Score: 72.8
        GIINTLQKYYCRVRGGRCALLSCLPKEEQIGKCSTRGRKCCRRKK
  • 3. L03A000252    From 23 To 67 E-value: 0.000000000000004 Score: 72
        GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 4. L03A000247    From 23 To 67 E-value: 0.000000000000004 Score: 72
        GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • 5. L01A000701    From 1 To 45 E-value: 0.000000000000005 Score: 71.6
        GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kuiper H.,Regenhard P.,Philipp U.,Paul S.,Looft C.,
  •   Title:Sequence analysis of a 212 kb defensin gene cluster on ECA 27q17.
  •   Journal:Gene, 2006, 376, 192-198  [PubMed:16723195]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: