Record in detail


General Info

  • lamp_id:L01A003450
  • Name:SPG11_MOUSE
  • FullName:Sperm-associated antigen 11
  • Source:Mus musculus
  • Mass:5952.9 Da
  • Sequence Length:52 aa
  • Isoelectric Point:8.63
  • Activity:Antibacterial
  • Sequence
        PGDIPPGIRNTVCLMQQGHCRLFMCRSGERKGDICSDPWNRCCVPYSVKDRR
  • Function:Antimicrobial peptide against E.coli. Is also responsible for sperm maturation, storage, and protection (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003450    From 1 To 52 E-value: 1e-26 Score: 109
        PGDIPPGIRNTVCLMQQGHCRLFMCRSGERKGDICSDPWNRCCVPYSVKDRR
  • 2. L13A012265    From 1 To 50 E-value: 1e-25 Score: 106
        PGDIPPGIRNTVCLMQQGHCRLFMCRSGERKGDICSDPWNRCCVPYSVKD
  • 3. L03A000186    From 19 To 68 E-value: 6e-23 Score: 97.8
        GDIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR
  • 4. L01A003362    From 1 To 49 E-value: 7e-22 Score: 94.4
        DIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR
  • 5. L12A08375|    From 19 To 69 E-value: 5e-20 Score: 88.2
        GDVPPGIRNIICLMQHGTCRLFFCRSGEKKSEICSDPWNRCCIPHSEEERK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Sperm_Ag_HE2    Interpro Link:IPR007988
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tomita T.,Fukuhara S.,Makita R.,Nagase T.,Yamaguchi Y.,
  •   Title:Identification of multiple novel epididymis-specific beta-defensin isoforms in humans and mice.
  •   Journal:J. Immunol., 2002, 169, 2516-2523  [MEDLINE:22181517]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]
  •   [3]  Frith M.C.,Gough J.,Katayama S.,Kasukawa T.,Carninci P.,
  •   Title:The transcriptional landscape of the mammalian genome.
  •   Journal:Science, 2005, 309, 1559-1563  [PubMed:16141072]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: