Record in detail

Top similar AMPs on LAMP
1. L12A01514| From 3 To 45 E-value: 5e-21 Score: 91.3
LKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC
2. L12A01513| From 3 To 45 E-value: 1e-20 Score: 90.1
LKKCWNNYVQGHCRKICRVNELPEALCENGRYCCLNIKELEAC
3. L12A01515| From 3 To 45 E-value: 2e-20 Score: 89.4
LKKCWNNYVQRHCRKICRVNEVPEALCENGRYCCLNIKELEAC
4. L02A000197 From 2 To 44 E-value: 5e-20 Score: 88.2
LKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC
5. L01A003451 From 1 To 43 E-value: 6e-20 Score: 87.8
LKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC

Reference
[1] Gilbert J.G.R.,Burton J.,Ashurst J.L.,Matthews L.H.,Deloukas P.,
Title:The DNA sequence and comparative analysis of human chromosome 20.
Journal:Nature, 2001, 414, 865-871 [MEDLINE:21638749]
[2] Jia H.P.,Walters J.D.,Bartlett J.A.,Mitros J.P.,Schutte B.C.,
Title:Discovery of five conserved beta-defensin gene clusters using a computational search strategy.
Journal:Proc. Natl. Acad. Sci. U.S.A., 2002, 99, 2129-2133 [MEDLINE:21843921]
[3] Conejo-Garcia J.-R.,Forssmann W.-G.,Schulz S.,Krause A.,Rodriguez-Jimenez F.-J.,
Title:Distribution of new human beta-defensin genes clustered on chromosome 20 in functionally different segments of epididymis.
Journal:Genomics, 2003, 81, 175-183 [PubMed:12620395]
[4] Baldwin D.T.,Baker K.,Abaya E.,Gurney A.L.,Clark H.F.,
Title:The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
Journal:Genome Res., 2003, 13, 2265-2270 [MEDLINE:22887296]
[5] Henzel W.J.,Zhang Z.,
Title:Signal peptide prediction based on analysis of experimentally verified cleavage sites.
Journal:Protein Sci., 2004, 13, 2819-2824 [PubMed:15340161]
[6]
Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
Journal:Genome Res., 2004, 14, 2121-2127 [PubMed:15489334]