Record in detail


General Info

  • lamp_id:L01A003461
  • Name:LANNU_STRUB
  • FullName:Lantibiotic nisin-U
  • Source:Streptococcus uberis
  • Mass:3173.8 Da
  • Sequence Length:31 aa
  • Isoelectric Point:8.52
  • Activity:Antibacterial
  • Sequence
        ITSKSLCTPGCKTGILMTCPLKTATCGCHFG
  • Function:Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08806|    From 25 To 55 E-value: 0.0000000000006 Score: 64.7
        ITSKSLCTPGCKTGILMTCPLKTATCGCHFG
  • 2. L12A08807|    From 25 To 55 E-value: 0.0000000000007 Score: 64.3
        VTSKSLCTPGCKTGILMTCPLKTATCGCHFG
  • 3. L01A003461    From 1 To 31 E-value: 0.000000000003 Score: 62.4
        ITSKSLCTPGCKTGILMTCPLKTATCGCHFG
  • 4. L12A08808|    From 25 To 55 E-value: 0.000000000004 Score: 62
        ITSKSLCTAGCKTGILMTCPLKTATCGCHFG
  • 5. L12A08809|    From 25 To 55 E-value: 0.000000000008 Score: 60.8
        VTSKSLCTPGCKTGILMTCAIKTATCGCHFG

Structure

  •   Domains
  •   1  Name:Lan    Interpro Link:IPR006079
  •   2  Name:Nisin    Interpro Link:IPR000446
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tagg J.R.,Jack R.W.,Klesse N.A.,Wirawan R.E.,
  •   Title:Molecular and genetic characterization of a novel nisin variant produced by Streptococcus uberis.
  •   Journal:Appl. Environ. Microbiol., 2006, 72, 1148-1156  [PubMed:16461661]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: