Record in detail


General Info

  • lamp_id:L01A003473
  • Name:DFA20_MOUSE
  • FullName:Alpha-defensin 20
  • Source:Mus musculus
  • Mass:3887.5 Da
  • Sequence Length:34 aa
  • Isoelectric Point:8.86
  • Activity:Antimicrobial
  • Sequence
        SRDLICYCRKGGCNRGEQVYGTCSGRLLYCCPRR
  • Function:May have microbicidal activities (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003473    From 1 To 34 E-value: 0.00000000000003 Score: 69.3
        SRDLICYCRKGGCNRGEQVYGTCSGRLLYCCPRR
  • 2. L12A08329|    From 60 To 92 E-value: 0.000000007 Score: 51.2
        RGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • 3. L03A000076    From 57 To 89 E-value: 0.000000008 Score: 50.8
        RGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • 4. L05ADEF199    From 2 To 34 E-value: 0.00000003 Score: 48.9
        RGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • 5. L01A000268    From 2 To 32 E-value: 0.00000008 Score: 47.4
        LLCYCRKGHCKRGERVRGTCGIRFLYCCPRR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: