Record in detail


General Info

  • lamp_id:L01A003475
  • Name:DEFB3_RAT
  • FullName:Beta-defensin 3
  • Source:Rattus norvegicus
  • Mass:4531.4 Da
  • Sequence Length:41 aa
  • Isoelectric Point:9.94
  • Activity:Antibacterial
  • Sequence
        KKVYNAVSCMTNGGICWLKCSGTFREIGSCGTRQLKCCKKK
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003475    From 1 To 41 E-value: 1e-18 Score: 83.2
        KKVYNAVSCMTNGGICWLKCSGTFREIGSCGTRQLKCCKKK
  • 2. L01A003599    From 1 To 41 E-value: 0.0000000003 Score: 55.5
        QSINNPVSCVTHGGICWGRCPGSFRQIGTCGLGKVRCCKKK
  • 3. L03A000249    From 23 To 63 E-value: 0.000000002 Score: 53.1
        QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK
  • 4. L01A003488    From 1 To 41 E-value: 0.000000003 Score: 52.4
        QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK
  • 5. L03A000243    From 23 To 63 E-value: 0.000000008 Score: 50.8
        KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: